(data stored in ACNUC7421 zone)

EMBL: CP002116.PE117

CP002116.PE117       Location/Qualifiers
FT   CDS             124082..125605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0119"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG3845 ABC-type uncharacterized transport
FT                   systems ATPase components; InterPro
FT                   IPR003593:IPR003439:IPR017871; KEGG: ctc:CTC00370 sugar
FT                   transport ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase; SPTR: Putative uncharacterized
FT                   protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79277"
FT                   /db_xref="GOA:E1R8D3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D3"
FT                   /protein_id="ADK79277.1"
FT                   /translation="MAQDGAFALRMEGISKFFPGVIANDRINLDCRRGEVLGILGENGA
FT                   GKTTLMNILYGLHQPDEGQIFLDGKQVTIDSPSKAIDLGVGMVHQHFMLVEALSALENV
FT                   ILGMPSKRITLDIESARKRLETLCEDYELHVDPSVEVWKMPVGKQQWLEILKALYRDIN
FT                   LLVLDEPSSVLTPSEGKQLFKAIRKITAEGRSVIFISHKLDEVLEVTDRITVIRDGRVV
FT                   GTVETKDASQEELTRMMVGRPVTITRKPRPVVTKDSPVLVMENVNADDDRGLPALKNFN
FT                   LTVRAGEIVGVAGVDGNGQRELAECIVGMRKYTSGSVQIQDRLIDRIIADTSFVGYIPE
FT                   DRQKTGLCLDMTVAENLIFKEVDNPPYLKNGILRLNSIKEHAQNMIQKYDIRTRSGDDL
FT                   VGNLSGGNQQKVIFAREINNEPVLVIASQATRGLDLGAVENVHNVLLNERNRGAAVLFI
FT                   STELQEVMSLSDRIIVMFRGELMGDVAGEGTDVSTIGRMMLGETLELDK"
     MAQDGAFALR MEGISKFFPG VIANDRINLD CRRGEVLGIL GENGAGKTTL MNILYGLHQP        60
     DEGQIFLDGK QVTIDSPSKA IDLGVGMVHQ HFMLVEALSA LENVILGMPS KRITLDIESA       120
     RKRLETLCED YELHVDPSVE VWKMPVGKQQ WLEILKALYR DINLLVLDEP SSVLTPSEGK       180
     QLFKAIRKIT AEGRSVIFIS HKLDEVLEVT DRITVIRDGR VVGTVETKDA SQEELTRMMV       240
     GRPVTITRKP RPVVTKDSPV LVMENVNADD DRGLPALKNF NLTVRAGEIV GVAGVDGNGQ       300
     RELAECIVGM RKYTSGSVQI QDRLIDRIIA DTSFVGYIPE DRQKTGLCLD MTVAENLIFK       360
     EVDNPPYLKN GILRLNSIKE HAQNMIQKYD IRTRSGDDLV GNLSGGNQQK VIFAREINNE       420
     PVLVIASQAT RGLDLGAVEN VHNVLLNERN RGAAVLFIST ELQEVMSLSD RIIVMFRGEL       480
     MGDVAGEGTD VSTIGRMMLG ETLELDK                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page