(data stored in ACNUC7421 zone)

EMBL: CP002116.PE118

CP002116.PE118       Location/Qualifiers
FT   CDS             125602..126717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0120"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG4603 ABC-type uncharacterized transport
FT                   system permease component; InterPro IPR001851; KEGG:
FT                   cyt:cce_2447 permease protein of sugar ABC transporter;
FT                   PFAM: inner-membrane translocator; SPTR: Putative
FT                   uncharacterized protein; PFAM: Branched-chain amino acid
FT                   transport system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79278"
FT                   /db_xref="GOA:E1R8D4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D4"
FT                   /protein_id="ADK79278.1"
FT                   /translation="MTKIKRPGILNLPGIGEVVLSSARPLLGIFLGLLAGALLIAISGV
FT                   NPFVAYWAMVQGAFGSPQAFANVLVRASPLLLAGVGVAIGIKAGIWNIGAEGYMYAGAI
FT                   GAAVVGIAPLSVHPFIHILLSVIAAMVFAAVWGLLPAFLRAYKGLNEVVTTIMMNYVAI
FT                   AFTSWLVHPPVFMAEPDSFFPMSLMIKPSAKIPFLMKGTSLHPGFIFGIIACIICFLVI
FT                   RYTPFGFRTRMLGVNPEASRYAGLNEKRQIMLVMLIGAVMGGVAGAFEVLGLKTRLYMD
FT                   FVSGVGYEAVAVALLSAGNPLGVIGSAFFFSALKAGGATMSIVTGVGKPMTIVIEALCV
FT                   LFVIALGYHKRKRLKREDKEIEDEEVQKGEQ"
     MTKIKRPGIL NLPGIGEVVL SSARPLLGIF LGLLAGALLI AISGVNPFVA YWAMVQGAFG        60
     SPQAFANVLV RASPLLLAGV GVAIGIKAGI WNIGAEGYMY AGAIGAAVVG IAPLSVHPFI       120
     HILLSVIAAM VFAAVWGLLP AFLRAYKGLN EVVTTIMMNY VAIAFTSWLV HPPVFMAEPD       180
     SFFPMSLMIK PSAKIPFLMK GTSLHPGFIF GIIACIICFL VIRYTPFGFR TRMLGVNPEA       240
     SRYAGLNEKR QIMLVMLIGA VMGGVAGAFE VLGLKTRLYM DFVSGVGYEA VAVALLSAGN       300
     PLGVIGSAFF FSALKAGGAT MSIVTGVGKP MTIVIEALCV LFVIALGYHK RKRLKREDKE       360
     IEDEEVQKGE Q                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page