(data stored in ACNUC7421 zone)

EMBL: CP002116.PE119

CP002116.PE119       Location/Qualifiers
FT   CDS             126707..127633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0121"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG1079 ABC-type transport system permease
FT                   component; InterPro IPR001851; KEGG: npu:Npun_R4718
FT                   inner-membrane translocator; PFAM: inner-membrane
FT                   translocator; SPTR: Putative uncharacterized protein; PFAM:
FT                   Branched-chain amino acid transport system / permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79279"
FT                   /db_xref="GOA:E1R8D5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D5"
FT                   /protein_id="ADK79279.1"
FT                   /translation="MNSEVIISWLQATLRWGGPLILVSIGEVYAERSGIINMGIEGIML
FT                   FGALTGIAVSFFTGSVLIAVLGTILLGTLFGMAFAFFTVDRRANHVVTGLMFNLAALGG
FT                   TNLLFAMLSETRSVRVATFPTLFPESFFDIPVLGPLLFRQSLITWIAFILPFISSRILY
FT                   RTNWGLNIRAVGDNPHAAATAGLNVNKYKYQAVILSGIFAALGGCALTLGDVGYFASGG
FT                   MTAGRGFVVLAAVVVGGWDPLKTALACLVFGAADAAQLRMQTIGSAIPYQFLQMLPYLI
FT                   TIAALAGLVGRTRPPKTWGASYDPEDI"
     MNSEVIISWL QATLRWGGPL ILVSIGEVYA ERSGIINMGI EGIMLFGALT GIAVSFFTGS        60
     VLIAVLGTIL LGTLFGMAFA FFTVDRRANH VVTGLMFNLA ALGGTNLLFA MLSETRSVRV       120
     ATFPTLFPES FFDIPVLGPL LFRQSLITWI AFILPFISSR ILYRTNWGLN IRAVGDNPHA       180
     AATAGLNVNK YKYQAVILSG IFAALGGCAL TLGDVGYFAS GGMTAGRGFV VLAAVVVGGW       240
     DPLKTALACL VFGAADAAQL RMQTIGSAIP YQFLQMLPYL ITIAALAGLV GRTRPPKTWG       300
     ASYDPEDI                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page