(data stored in ACNUC7421 zone)

EMBL: CP002116.PE12

CP002116.PE12        Location/Qualifiers
FT   CDS             complement(9730..10791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0012"
FT                   /product="metallophosphoesterase"
FT                   /note="InterPro IPR004843; KEGG: cch:Cag_0430 hypothetical
FT                   protein; PFAM: metallophosphoesterase; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79172"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6P0"
FT                   /protein_id="ADK79172.1"
FT                   /translation="MNKQFYHLKLEELYTKAKEIEIHDNQRFVIFSDLHVGNGKYGDDF
FT                   RPNAKLFQTALHDYYYEKGYTLILNGDIEELHRYTLAEIRSTWKSLYSLFDAFDAENRL
FT                   YKLSGNHDSKLFNLPGEPLRYKLYESLKLNYKGMTLFLFHGHQPSYFYEKFNEISGLLL
FT                   RFIAKPLRIKHYSVAHDKGRRFKIEKRTYEFSIEKNIVSIIGHTHRPLFESLSKLDSLK
FT                   YKIENLLRRYAKSGDEKQKFLEKQIEEIKKEIDKSIMTKGKEQAISSLYSSQTLAPSVF
FT                   NSGCVIGKRGMTAIEIKGGKISLVHWFNEDVDEKYRKNDGKNTSQLDNTGFFRTVLKRD
FT                   SLDYIFTKIRLLT"
     MNKQFYHLKL EELYTKAKEI EIHDNQRFVI FSDLHVGNGK YGDDFRPNAK LFQTALHDYY        60
     YEKGYTLILN GDIEELHRYT LAEIRSTWKS LYSLFDAFDA ENRLYKLSGN HDSKLFNLPG       120
     EPLRYKLYES LKLNYKGMTL FLFHGHQPSY FYEKFNEISG LLLRFIAKPL RIKHYSVAHD       180
     KGRRFKIEKR TYEFSIEKNI VSIIGHTHRP LFESLSKLDS LKYKIENLLR RYAKSGDEKQ       240
     KFLEKQIEEI KKEIDKSIMT KGKEQAISSL YSSQTLAPSV FNSGCVIGKR GMTAIEIKGG       300
     KISLVHWFNE DVDEKYRKND GKNTSQLDNT GFFRTVLKRD SLDYIFTKIR LLT              353
//

If you have problems or comments...

PBIL Back to PBIL home page