(data stored in ACNUC7421 zone)

EMBL: CP002116.PE120

CP002116.PE120       Location/Qualifiers
FT   CDS             127941..128690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0122"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG2188 Transcriptional regulators; InterPro
FT                   IPR000524:IPR011663; KEGG: btl:BALH_3421 GntR family
FT                   transcriptional regulator; PFAM: UbiC transcription
FT                   regulator-associated domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH; SPTR:
FT                   Transcriptional regulators; PFAM: Bacterial regulatory
FT                   proteins, gntR family; UTRA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79280"
FT                   /db_xref="GOA:E1R8D6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D6"
FT                   /protein_id="ADK79280.1"
FT                   /translation="MIKYPKVSDELLSVKVKKILFKMMKDGEFDKTGRLPSEAEIADKL
FT                   SVSRTVIRDVYRLLETEGYIIRRRGIGTLINYNVLYIKERLDVDHVDEFYNLVRESNNT
FT                   PETRFLEYCELAATPELAERFNIEPGDLLICLKRVITADGIPVIYCENYFPKVFLCKKI
FT                   SSENDFKRPIFEFMEHYCNMRIHHEIANIKPILLSKKMISIFNIENTEPALKLQEISYN
FT                   IEQQPILYSYEFHRSGILEHTLLRKRI"
     MIKYPKVSDE LLSVKVKKIL FKMMKDGEFD KTGRLPSEAE IADKLSVSRT VIRDVYRLLE        60
     TEGYIIRRRG IGTLINYNVL YIKERLDVDH VDEFYNLVRE SNNTPETRFL EYCELAATPE       120
     LAERFNIEPG DLLICLKRVI TADGIPVIYC ENYFPKVFLC KKISSENDFK RPIFEFMEHY       180
     CNMRIHHEIA NIKPILLSKK MISIFNIENT EPALKLQEIS YNIEQQPILY SYEFHRSGIL       240
     EHTLLRKRI                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page