(data stored in ACNUC7421 zone)

EMBL: CP002116.PE121

CP002116.PE121       Location/Qualifiers
FT   CDS             128879..129154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0124"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="InterPro IPR002514; KEGG: cth:Cthe_0590 transposase
FT                   IS3/IS911; PFAM: transposase IS3/IS911 family protein;
FT                   SPTR: Transposase IS3/IS911; PFAM: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79281"
FT                   /db_xref="GOA:E1R8D7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D7"
FT                   /protein_id="ADK79281.1"
FT                   /translation="MSKRRRKFTSEQKFQIVIEAIKGERQISEIAAQYQVHPNQISNWK
FT                   KQFLEKGATVFNTKADDSKKILEETQEDLFKKIGQQQYEIEWLKKT"
     MSKRRRKFTS EQKFQIVIEA IKGERQISEI AAQYQVHPNQ ISNWKKQFLE KGATVFNTKA        60
     DDSKKILEET QEDLFKKIGQ QQYEIEWLKK T                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page