(data stored in ACNUC7421 zone)

EMBL: CP002116.PE122

CP002116.PE122       Location/Qualifiers
FT   CDS             129183..129998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0125"
FT                   /product="Integrase catalytic region"
FT                   /note="COGs: COG2801 Transposase and inactivated
FT                   derivatives; InterPro IPR001584; KEGG: glo:Glov_3665
FT                   integrase catalytic region; PFAM: Integrase catalytic
FT                   region; SPTR: Integrase catalytic region; PFAM: Integrase
FT                   core domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79282"
FT                   /db_xref="GOA:E1R8D8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D8"
FT                   /protein_id="ADK79282.1"
FT                   /translation="MISPDEKLSISRQCKLVSLNRSSLYYKSMPVKGENIELMKRIDEL
FT                   YTDNPDFGSRQIRNSLRREGRKINRKRVQRLMRDMGIMAIFPGRNLSKPGIGSEHKVYP
FT                   YLLRKLSISRPNQVWATDITYIRLAHGFVYLVAIIDWYSRKILSHEISTTMDQEFCISA
FT                   YRMAITQYGNPEILNSDQGSQFTSKEYRKLVLGSGATFSMDGKGRALDNIAIERFWRTL
FT                   KYGEVYLKEYESVREAKDGIKALIEKYNSRRPHTKHGISTPDEVFGVAA"
     MISPDEKLSI SRQCKLVSLN RSSLYYKSMP VKGENIELMK RIDELYTDNP DFGSRQIRNS        60
     LRREGRKINR KRVQRLMRDM GIMAIFPGRN LSKPGIGSEH KVYPYLLRKL SISRPNQVWA       120
     TDITYIRLAH GFVYLVAIID WYSRKILSHE ISTTMDQEFC ISAYRMAITQ YGNPEILNSD       180
     QGSQFTSKEY RKLVLGSGAT FSMDGKGRAL DNIAIERFWR TLKYGEVYLK EYESVREAKD       240
     GIKALIEKYN SRRPHTKHGI STPDEVFGVA A                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page