(data stored in ACNUC7421 zone)

EMBL: CP002116.PE123

CP002116.PE123       Location/Qualifiers
FT   CDS             complement(130540..131487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0126"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cdl:CDR20291_0238 flagellar cap protein; SPTR:
FT                   Flagellar cap protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79283"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D9"
FT                   /protein_id="ADK79283.1"
FT                   /translation="MKKLLTALVLSMILFGCSTSIPVQMTVPPNLNYGGARTIGVIPFT
FT                   TSSEDASEATKDLRYYFSWYNSRALHDDLKLASALTSKVESVLASSDYFTVISTEQLQQ
FT                   QAANGTITAEAVVTGKIASVLDDYNKEYNERTDADGNTTKVPEYTREAQITVVFKILSA
FT                   SDLTVLDTIEYTVTAKDTANKYEALKSKEAVRFQAIDRIVNKVTYDLIPKTYTEYRTMA
FT                   KLENDKDPRVERINDLIKGDFYQEAYDLYMEIYSETSDFAALYNAILLTEVMGDYDKAL
FT                   DDMTQLAKTSGDKRAIAQMNRMKKQKADREALGE"
     MKKLLTALVL SMILFGCSTS IPVQMTVPPN LNYGGARTIG VIPFTTSSED ASEATKDLRY        60
     YFSWYNSRAL HDDLKLASAL TSKVESVLAS SDYFTVISTE QLQQQAANGT ITAEAVVTGK       120
     IASVLDDYNK EYNERTDADG NTTKVPEYTR EAQITVVFKI LSASDLTVLD TIEYTVTAKD       180
     TANKYEALKS KEAVRFQAID RIVNKVTYDL IPKTYTEYRT MAKLENDKDP RVERINDLIK       240
     GDFYQEAYDL YMEIYSETSD FAALYNAILL TEVMGDYDKA LDDMTQLAKT SGDKRAIAQM       300
     NRMKKQKADR EALGE                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page