(data stored in ACNUC7421 zone)

EMBL: CP002116.PE124

CP002116.PE124       Location/Qualifiers
FT   CDS             complement(131721..132242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0127"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="COGs: COG1247 Sortase and related acyltransferase;
FT                   InterPro IPR000182; KEGG: rcu:RCOM_1843230 hypothetical
FT                   protein; PFAM: GCN5-related N-acetyltransferase; SPTR:
FT                   GCN5-related N-acetyltransferase; PFAM: Acetyltransferase
FT                   (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79284"
FT                   /db_xref="GOA:E1R8E0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8E0"
FT                   /protein_id="ADK79284.1"
FT                   /translation="MKLIDCGRSFASSILDIYNEAIIHSTALYDYKPRTIESMGTWFDD
FT                   KEKKGFPIIGLVDDKNRLIGFGTYGNFRARPAYHYTVEHSIYIQKEYRGCGYGELLLRE
FT                   IIAKAAEQDYHCLIAGIDSENAASIHLHKKLGFSLCGELKQVGYKFGRWLNLVFYQLIL
FT                   PTPQEPQREI"
     MKLIDCGRSF ASSILDIYNE AIIHSTALYD YKPRTIESMG TWFDDKEKKG FPIIGLVDDK        60
     NRLIGFGTYG NFRARPAYHY TVEHSIYIQK EYRGCGYGEL LLREIIAKAA EQDYHCLIAG       120
     IDSENAASIH LHKKLGFSLC GELKQVGYKF GRWLNLVFYQ LILPTPQEPQ REI              173
//

If you have problems or comments...

PBIL Back to PBIL home page