(data stored in ACNUC7421 zone)

EMBL: CP002116.PE125

CP002116.PE125       Location/Qualifiers
FT   CDS             complement(132244..133020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0128"
FT                   /product="putative esterase"
FT                   /note="COGs: COG0627 esterase; InterPro IPR000801; KEGG:
FT                   bbe:BBR47_31170 hypothetical protein; PFAM: putative
FT                   esterase; SPTR: Putative uncharacterized protein; PFAM:
FT                   Putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79285"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8E1"
FT                   /protein_id="ADK79285.1"
FT                   /translation="MILRGSFFSQILEMETGLSILIPNRTIDTPPYRVAYLLHGLCGRN
FT                   GDWLDYTMLPAYAEVFDIMFIMPEVARSFYTDMVFGQKFFTYIHQELPVIVKKVFNISA
FT                   KREDTLVIGASMGGYGALKCALSYPDQYGYCAAFSSACLFLKEGLERQQRYGKTAEMEK
FT                   QYGKQLLNDFESIFGQALEWKPEYELLELAKSRPAPPRLYLACGTADHLKDENQRFSHE
FT                   LEKLNIPHRYEEWPGGHDWNFFNKALEKALRGINEV"
     MILRGSFFSQ ILEMETGLSI LIPNRTIDTP PYRVAYLLHG LCGRNGDWLD YTMLPAYAEV        60
     FDIMFIMPEV ARSFYTDMVF GQKFFTYIHQ ELPVIVKKVF NISAKREDTL VIGASMGGYG       120
     ALKCALSYPD QYGYCAAFSS ACLFLKEGLE RQQRYGKTAE MEKQYGKQLL NDFESIFGQA       180
     LEWKPEYELL ELAKSRPAPP RLYLACGTAD HLKDENQRFS HELEKLNIPH RYEEWPGGHD       240
     WNFFNKALEK ALRGINEV                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page