(data stored in ACNUC7421 zone)

EMBL: CP002116.PE126

CP002116.PE126       Location/Qualifiers
FT   CDS             133393..134100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0129"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="InterPro IPR018060:IPR000005; KEGG: ppf:Pput_2324
FT                   AraC family transcriptional regulator; PFAM:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; SPTR: Transcriptional
FT                   regulator, AraC family; PFAM: AraC-like ligand binding
FT                   domain; Bacterial regulatory helix-turn-helix proteins,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79286"
FT                   /db_xref="GOA:E1R8E2"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8E2"
FT                   /protein_id="ADK79286.1"
FT                   /translation="MIKILRYCSDPVCELKWGWGEHAVRKHAHSLWSFSIVLSGRTQIA
FT                   LGRDRAILSAGSSIAIPSGVAHLCTPEKEPPFTFAVLYCDERWLKTCGVDSDRILWGRL
FT                   GAQEFQEMLHTSKGTEAGRMLGSLLQRFERILPDVDRLTFPKNADSGFAPVSIRSTSEN
FT                   RFKAYRQYAQRYSLGPHAVRQNRRIELAKAALRTGLSVAETAAACEFYDQSHFVKTFRL
FT                   YTGTTPSLYKKGI"
     MIKILRYCSD PVCELKWGWG EHAVRKHAHS LWSFSIVLSG RTQIALGRDR AILSAGSSIA        60
     IPSGVAHLCT PEKEPPFTFA VLYCDERWLK TCGVDSDRIL WGRLGAQEFQ EMLHTSKGTE       120
     AGRMLGSLLQ RFERILPDVD RLTFPKNADS GFAPVSIRST SENRFKAYRQ YAQRYSLGPH       180
     AVRQNRRIEL AKAALRTGLS VAETAAACEF YDQSHFVKTF RLYTGTTPSL YKKGI            235
//

If you have problems or comments...

PBIL Back to PBIL home page