(data stored in ACNUC7421 zone)

EMBL: CP002116.PE128

CP002116.PE128       Location/Qualifiers
FT   CDS             complement(134625..135299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0131"
FT                   /product="YheO domain protein"
FT                   /note="COGs: COG2964 conserved hypothetical protein;
FT                   InterPro IPR013559; KEGG: ckr:CKR_0542 hypothetical
FT                   protein; PFAM: YheO domain protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: YheO-like PAS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79288"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8E4"
FT                   /protein_id="ADK79288.1"
FT                   /translation="MNDAMKKQYSIIVEFLGKALGPDYEVVLHDVDDHINSIVAIANGH
FT                   VSHRSVGGPMTNFGLEVISEERYKKEDYKINYNGISKDQRILRSSTLFIKDEKDEIAGL
FT                   LCINFDDRRYKALSENILKLCHPDKLVELNTSYDSSTIVDNAEERFYGSAAEEISSVLD
FT                   KYLSENGIPSDRLSQDDRLHVVDILNQKGIFMVKGAVKEAAKQLACSEPTIYRYINKVN
FT                   NE"
     MNDAMKKQYS IIVEFLGKAL GPDYEVVLHD VDDHINSIVA IANGHVSHRS VGGPMTNFGL        60
     EVISEERYKK EDYKINYNGI SKDQRILRSS TLFIKDEKDE IAGLLCINFD DRRYKALSEN       120
     ILKLCHPDKL VELNTSYDSS TIVDNAEERF YGSAAEEISS VLDKYLSENG IPSDRLSQDD       180
     RLHVVDILNQ KGIFMVKGAV KEAAKQLACS EPTIYRYINK VNNE                        224
//

If you have problems or comments...

PBIL Back to PBIL home page