(data stored in ACNUC7421 zone)

EMBL: CP002116.PE129

CP002116.PE129       Location/Qualifiers
FT   CDS             complement(135466..136797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0132"
FT                   /product="sodium:neurotransmitter symporter"
FT                   /note="COGs: COG0733 Na+-dependent transporter of the SNF
FT                   family; InterPro IPR000175; KEGG: ctc:CTC01190
FT                   sodium-dependent amino acid transporter (proline,
FT                   tryptophan); PFAM: sodium:neurotransmitter symporter; SPTR:
FT                   Transporter; PFAM: Sodium:neurotransmitter symporter
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79289"
FT                   /db_xref="GOA:E1R8E5"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8E5"
FT                   /protein_id="ADK79289.1"
FT                   /translation="MDDKSAEITRDSFNTRIGFILACIGSAVGMANLWLFPYRIGQFGG
FT                   AAFLIPYCLSIIVIGLVGVIGEMSFGRAMRTGPLGSFKKAFLRRGKKHGELLGLIPVIG
FT                   SLGIAIGYAVVVGWILRFVVGSITGAVINTTDSAAYFGKIAGPLGSIGWHFTGLALTFV
FT                   IMLMGIAKGIEKVNKFMMPTFFILFVLLAIRVLTLPGSIEGYRYLFIPKWELLAKPKTW
FT                   VYALGQAFFSLSLAGSGTVVYGSYLKNTEDVVSCAKNVALYDTIAALLAAIVILPAVFV
FT                   FHLDPTAGPPLMFITMPNVFKMMPMGYLFSIIFFVAVLFAGISSLMNLLETPVEAIQQR
FT                   FKVSRGTAIAVVAIISASAGLILENGSTLGTWMDIVSIYIIPLGALLSGIMFFWVCGPG
FT                   FARQQAQTGRKKKIGRWFEPMTKYVFCGFTILIYILGILYGGIG"
     MDDKSAEITR DSFNTRIGFI LACIGSAVGM ANLWLFPYRI GQFGGAAFLI PYCLSIIVIG        60
     LVGVIGEMSF GRAMRTGPLG SFKKAFLRRG KKHGELLGLI PVIGSLGIAI GYAVVVGWIL       120
     RFVVGSITGA VINTTDSAAY FGKIAGPLGS IGWHFTGLAL TFVIMLMGIA KGIEKVNKFM       180
     MPTFFILFVL LAIRVLTLPG SIEGYRYLFI PKWELLAKPK TWVYALGQAF FSLSLAGSGT       240
     VVYGSYLKNT EDVVSCAKNV ALYDTIAALL AAIVILPAVF VFHLDPTAGP PLMFITMPNV       300
     FKMMPMGYLF SIIFFVAVLF AGISSLMNLL ETPVEAIQQR FKVSRGTAIA VVAIISASAG       360
     LILENGSTLG TWMDIVSIYI IPLGALLSGI MFFWVCGPGF ARQQAQTGRK KKIGRWFEPM       420
     TKYVFCGFTI LIYILGILYG GIG                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page