(data stored in ACNUC7421 zone)

EMBL: CP002116.PE13

CP002116.PE13        Location/Qualifiers
FT   CDS             complement(10866..11339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0013"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="COGs: COG1762 Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain (Ntr-type); InterPro
FT                   IPR002178; KEGG: cca:CCA00348 PTS system,IIA component;
FT                   PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; SPTR: PTS system,IIA
FT                   component; PFAM: Phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79173"
FT                   /db_xref="GOA:E1R6P1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6P1"
FT                   /protein_id="ADK79173.1"
FT                   /translation="MVTLCRLIGKNGICQLSKTNKSQAILELISHARQFANKPWADDFY
FT                   CEVMRKELLQSTGLGKGIAVAHGTCQGIDQVYVALGISQEGIEYDAIDSQPVHLLFLVA
FT                   NPPETQLEYLSALSTLVRLLRNDSFREKIMHCVTAEQVYLLFKQRGCTIPIRT"
     MVTLCRLIGK NGICQLSKTN KSQAILELIS HARQFANKPW ADDFYCEVMR KELLQSTGLG        60
     KGIAVAHGTC QGIDQVYVAL GISQEGIEYD AIDSQPVHLL FLVANPPETQ LEYLSALSTL       120
     VRLLRNDSFR EKIMHCVTAE QVYLLFKQRG CTIPIRT                                157
//

If you have problems or comments...

PBIL Back to PBIL home page