(data stored in ACNUC7421 zone)

EMBL: CP002116.PE130

CP002116.PE130       Location/Qualifiers
FT   CDS             complement(136871..138253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0133"
FT                   /product="Tryptophanase"
FT                   /EC_number="4.1.99.1"
FT                   /note="COGs: COG3033 Tryptophanase; InterPro
FT                   IPR001597:IPR011166:IPR018176; KEGG: ctc:CTC01509
FT                   tryptophanase; PFAM: aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; PRIAM: Tryptophanase; SPTR:
FT                   Tryptophanase; PFAM: Beta-eliminating lyase; TIGRFAM:
FT                   tryptophanase, leader peptide-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79290"
FT                   /db_xref="GOA:E1R8E6"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR011166"
FT                   /db_xref="InterPro:IPR013440"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018176"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8E6"
FT                   /protein_id="ADK79290.1"
FT                   /translation="MAITYLPEPFRIKMVETIKMLTPEEREQRIAEAKYNLFNLKGKDV
FT                   YIDLLTDSGTNAMSQEQWAGVMKGDEAYAGGASYYKLLEAAQDITGYAYIQPVHQGRAA
FT                   EKVLFGILMGKGQFSISNMHFDTTRAHVELTGARAIDCVVSDAMDPAKRAPFKGNMDVD
FT                   KLESLIKKYGAEKVALVVMTVTNNSAGGQPVSMQNIRETASVCKKYNIKFCIDAARFAE
FT                   NAFFIKKREDGYRDASIKDITNEMFSYADMFTMSAKKDAIVNMGGLIGIKDDAELFSAC
FT                   KGRTISFEGFITYGGLSGRDLESLAIGLYEGIDENQLRYRIGQIEYLASRLDDAGITYQ
FT                   APAGGHGIFVDAKALLPHIPYYEFPGQALAVELYKEAGIRTCDIGSYMLGNDPDTGKQL
FT                   HAEFEFTRLAIPRRVYTQAHIDVMAEALIEIKKRANRVKGYKITWEPPVLRHFQASLKP
FT                   LT"
     MAITYLPEPF RIKMVETIKM LTPEEREQRI AEAKYNLFNL KGKDVYIDLL TDSGTNAMSQ        60
     EQWAGVMKGD EAYAGGASYY KLLEAAQDIT GYAYIQPVHQ GRAAEKVLFG ILMGKGQFSI       120
     SNMHFDTTRA HVELTGARAI DCVVSDAMDP AKRAPFKGNM DVDKLESLIK KYGAEKVALV       180
     VMTVTNNSAG GQPVSMQNIR ETASVCKKYN IKFCIDAARF AENAFFIKKR EDGYRDASIK       240
     DITNEMFSYA DMFTMSAKKD AIVNMGGLIG IKDDAELFSA CKGRTISFEG FITYGGLSGR       300
     DLESLAIGLY EGIDENQLRY RIGQIEYLAS RLDDAGITYQ APAGGHGIFV DAKALLPHIP       360
     YYEFPGQALA VELYKEAGIR TCDIGSYMLG NDPDTGKQLH AEFEFTRLAI PRRVYTQAHI       420
     DVMAEALIEI KKRANRVKGY KITWEPPVLR HFQASLKPLT                             460
//

If you have problems or comments...

PBIL Back to PBIL home page