(data stored in ACNUC7421 zone)

EMBL: CP002116.PE131

CP002116.PE131       Location/Qualifiers
FT   CDS             complement(138283..138666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0134"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="COGs: COG0251 Putative translation initiation
FT                   inhibitor yjgF family; InterPro
FT                   IPR006056:IPR006175:IPR019897; KEGG: tde:TDE2069
FT                   endoribonuclease L-PSP, putative; PFAM: Endoribonuclease
FT                   L-PSP; SPTR: Translation initiation inhibitor protein;
FT                   TIGRFAM: endoribonuclease L-PSP; PFAM: Endoribonuclease
FT                   L-PSP; TIGRFAM: endoribonuclease L-PSP, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79291"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8E7"
FT                   /protein_id="ADK79291.1"
FT                   /translation="MIKRIVTEKAPPAIGPYSQAVETDTLIFVSGQLPINPATGCFASA
FT                   EIKGQTQQSVENVKQVLQARGLDLDRVVKTTVFLSDMKNFTSMNEVYREMFDQESVPAR
FT                   SAVEVSRLPKDALVEIEAIAAKN"
     MIKRIVTEKA PPAIGPYSQA VETDTLIFVS GQLPINPATG CFASAEIKGQ TQQSVENVKQ        60
     VLQARGLDLD RVVKTTVFLS DMKNFTSMNE VYREMFDQES VPARSAVEVS RLPKDALVEI       120
     EAIAAKN                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page