(data stored in ACNUC7421 zone)

EMBL: CP002116.PE132

CP002116.PE132       Location/Qualifiers
FT   CDS             complement(138846..140063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79292"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8E8"
FT                   /protein_id="ADK79292.1"
FT                   /translation="METTQTVFAARVYYMQTALEVLADLMTTSEDIDREWRRFSLAAGP
FT                   FSGETKRRVFQTARVGSILTDPESTRAFARRIAPKVDLNIKAVLEHFTTYPWFYTIFEV
FT                   EKIVGDGFLIAKIRDSHEMLFSKPAEAKAREGGGCMLGLLFFNGACFQSWGEVVLLDSF
FT                   FEGDIRFFARTAACREYEEKGIESAIIASPLPFLLLREFSKLPQTLFHGEIARACSSQL
FT                   TLSSDIKCLIDQCRCKRQIIENDRYLRICLGGNLVTNPPTLYLDKKDHSLTLATFTLEG
FT                   YRKARFALLSSVEFPEKPQQAVSSAMQYAVFQLFKVQPYWMSFDATFLADEQDTAPLHC
FT                   LERVVYYRTRNGNLPPPDIVAEESGQDQRSAEIFLHAIQTIWDEAATKKASPGQRECTN
FT                   RRNCAA"
     METTQTVFAA RVYYMQTALE VLADLMTTSE DIDREWRRFS LAAGPFSGET KRRVFQTARV        60
     GSILTDPEST RAFARRIAPK VDLNIKAVLE HFTTYPWFYT IFEVEKIVGD GFLIAKIRDS       120
     HEMLFSKPAE AKAREGGGCM LGLLFFNGAC FQSWGEVVLL DSFFEGDIRF FARTAACREY       180
     EEKGIESAII ASPLPFLLLR EFSKLPQTLF HGEIARACSS QLTLSSDIKC LIDQCRCKRQ       240
     IIENDRYLRI CLGGNLVTNP PTLYLDKKDH SLTLATFTLE GYRKARFALL SSVEFPEKPQ       300
     QAVSSAMQYA VFQLFKVQPY WMSFDATFLA DEQDTAPLHC LERVVYYRTR NGNLPPPDIV       360
     AEESGQDQRS AEIFLHAIQT IWDEAATKKA SPGQRECTNR RNCAA                       405
//

If you have problems or comments...

PBIL Back to PBIL home page