(data stored in ACNUC7421 zone)

EMBL: CP002116.PE134

CP002116.PE134       Location/Qualifiers
FT   CDS             140833..141891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0137"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="InterPro IPR006675:IPR006674; KEGG: sus:Acid_4618
FT                   metal dependent phosphohydrolase; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; SPTR: Metal dependent
FT                   phosphohydrolase; TIGRFAM: metal dependent phophohydrolase;
FT                   PFAM: HD domain; TIGRFAM: uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79294"
FT                   /db_xref="GOA:E1R8F0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F0"
FT                   /protein_id="ADK79294.1"
FT                   /translation="MDPVECLAEAGHNSAYVLWSALDGYFGSDSSSDYQIACTEATLPQ
FT                   LAGMPGALEFPGSEWADAIWYPADRGRGVMLRCVDALDVAPPSTVIQGRLLRMPGKAWY
FT                   RDPFGCYPLLRNSQLSVDFEDEGSWLDAAEIAIYLSRYDYRLPEKGFGPKRFTGLKLLP
FT                   GEQRMLLMLMLGGEHPDRGLRFLFDCGFIEEHWPLFLSMARTHQSKDFHPEGNVWDHTL
FT                   ATLVHRKKADPELGLALLLHDCGKPSSHRSEGNQFHRHAQIGAAVAVRFLRSLEFDEEV
FT                   IRRIRYLVANHMVPSFLSASPPPAIAEVLDHELFPLLLELFRCDISSSFRGPEPYYQAC
FT                   KLYRNWKRKRRV"
     MDPVECLAEA GHNSAYVLWS ALDGYFGSDS SSDYQIACTE ATLPQLAGMP GALEFPGSEW        60
     ADAIWYPADR GRGVMLRCVD ALDVAPPSTV IQGRLLRMPG KAWYRDPFGC YPLLRNSQLS       120
     VDFEDEGSWL DAAEIAIYLS RYDYRLPEKG FGPKRFTGLK LLPGEQRMLL MLMLGGEHPD       180
     RGLRFLFDCG FIEEHWPLFL SMARTHQSKD FHPEGNVWDH TLATLVHRKK ADPELGLALL       240
     LHDCGKPSSH RSEGNQFHRH AQIGAAVAVR FLRSLEFDEE VIRRIRYLVA NHMVPSFLSA       300
     SPPPAIAEVL DHELFPLLLE LFRCDISSSF RGPEPYYQAC KLYRNWKRKR RV               352
//

If you have problems or comments...

PBIL Back to PBIL home page