(data stored in ACNUC7421 zone)

EMBL: CP002116.PE135

CP002116.PE135       Location/Qualifiers
FT   CDS             142012..143247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0138"
FT                   /product="putative two component, sigma54 specific,
FT                   transcriptional regulator, Fis family"
FT                   /note="COGs: COG2204 Response regulator containing
FT                   CheY-like receiver AAA-type ATPase and DNA-binding domains;
FT                   InterPro IPR001789:IPR003593:IPR002078; KEGG: dae:Dtox_1013
FT                   two component, sigma54 specific, transcriptional regulator,
FT                   Fis family; PFAM: sigma-54 factor interaction
FT                   domain-containing protein; response regulator receiver;
FT                   SMART: response regulator receiver; AAA ATPase; SPTR: Two
FT                   component, sigma54 specific, transcriptional regulator, Fis
FT                   family; PFAM: Response regulator receiver domain; Sigma-54
FT                   interaction domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79295"
FT                   /db_xref="GOA:E1R8F1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F1"
FT                   /protein_id="ADK79295.1"
FT                   /translation="MITILYIDDDLHDGELVHSMLFGYRVVLARNGTAGLEAYYRFMPD
FT                   IVILDILLPDMNGLELLDRLPTGCEQHPEIIALSGVADPGLAQEVRRRGVKKFLRKPIE
FT                   SKILKGAINELLRGNGAAGHGQLQEHPPEYENTLNVKSPAFASIIGSSRIISRLKDRAH
FT                   RYARCSFPVLILGESGTGKELFAKSIHELSRRCKDPFIVLNCAALPDTLIESELFGTEA
FT                   GAFTGAVNRAGGFELANGGTLFLDEIGELSPSGQAKLLRILEEKVVYRLGSRRARKIDV
FT                   RFVAATNKDLFLRAEGGMFRKDLFYRISGLELHIPPLRERKEDIEELSDTILRKGVEGA
FT                   ESNRHYRLSAGALAQLRAHHWPGNVRELEHVLHRAMLHSDSAVIEAAHLEISRNGRGYA
FT                   SLPMDEKQLPLF"
     MITILYIDDD LHDGELVHSM LFGYRVVLAR NGTAGLEAYY RFMPDIVILD ILLPDMNGLE        60
     LLDRLPTGCE QHPEIIALSG VADPGLAQEV RRRGVKKFLR KPIESKILKG AINELLRGNG       120
     AAGHGQLQEH PPEYENTLNV KSPAFASIIG SSRIISRLKD RAHRYARCSF PVLILGESGT       180
     GKELFAKSIH ELSRRCKDPF IVLNCAALPD TLIESELFGT EAGAFTGAVN RAGGFELANG       240
     GTLFLDEIGE LSPSGQAKLL RILEEKVVYR LGSRRARKID VRFVAATNKD LFLRAEGGMF       300
     RKDLFYRISG LELHIPPLRE RKEDIEELSD TILRKGVEGA ESNRHYRLSA GALAQLRAHH       360
     WPGNVRELEH VLHRAMLHSD SAVIEAAHLE ISRNGRGYAS LPMDEKQLPL F                411
//

If you have problems or comments...

PBIL Back to PBIL home page