(data stored in ACNUC7421 zone)

EMBL: CP002116.PE136

CP002116.PE136       Location/Qualifiers
FT   CDS             complement(143261..143803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tgo:TGME49_018300 zinc finger (CCCH type)
FT                   protein, putative; SPTR: Filamentous haemagglutinin family
FT                   N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79296"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F2"
FT                   /protein_id="ADK79296.1"
FT                   /translation="MKQSAKQWAVLDRHVSTFYNIMMRRSFHHFFSFFLLLFCFAISFS
FT                   NAQTIAPEIDLKTLYLSVNSSQPPEINQNQTLAIDGTVSAREILQPAEEGFIGLLELTV
FT                   GEWEGLESVEVYRCYVQLEGDRFADMIPAGRTRETSPTEIPLNTKVLVFGTYIGYSEDA
FT                   QGNRYPVLLGNAVRIIR"
     MKQSAKQWAV LDRHVSTFYN IMMRRSFHHF FSFFLLLFCF AISFSNAQTI APEIDLKTLY        60
     LSVNSSQPPE INQNQTLAID GTVSAREILQ PAEEGFIGLL ELTVGEWEGL ESVEVYRCYV       120
     QLEGDRFADM IPAGRTRETS PTEIPLNTKV LVFGTYIGYS EDAQGNRYPV LLGNAVRIIR       180
//

If you have problems or comments...

PBIL Back to PBIL home page