(data stored in ACNUC7421 zone)

EMBL: CP002116.PE137

CP002116.PE137       Location/Qualifiers
FT   CDS             143872..144423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0140"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="COGs: COG1366 Anti-anti-sigma regulatory factor
FT                   (antagonist of anti-sigma factor); InterPro
FT                   IPR003658:IPR002645; KEGG: tde:TDE2083 anti-anti-sigma
FT                   factor; PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; SPTR: Anti-sigma factor antagonist;
FT                   TIGRFAM: anti-anti-sigma factor; PFAM: STAS domain;
FT                   TIGRFAM: anti-anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79297"
FT                   /db_xref="GOA:E1R8F3"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F3"
FT                   /protein_id="ADK79297.1"
FT                   /translation="MNNNDIVPGFDDEKDDSLKIRLQKVDDVEGCLVLYLTGYIDTYNS
FT                   NFFQKRVTKAVEHNFTRLIFNCGGLNYVSSTGIGSFTAFLKAVKPRGGDLVLLEIQPKV
FT                   YEVFQLLGFSQFFNIKDNLNEAVEFFSSEGKSGATDVFPKIFQCPICSKKLKATKSGRF
FT                   RCSECKTILAIDNAGQVFLG"
     MNNNDIVPGF DDEKDDSLKI RLQKVDDVEG CLVLYLTGYI DTYNSNFFQK RVTKAVEHNF        60
     TRLIFNCGGL NYVSSTGIGS FTAFLKAVKP RGGDLVLLEI QPKVYEVFQL LGFSQFFNIK       120
     DNLNEAVEFF SSEGKSGATD VFPKIFQCPI CSKKLKATKS GRFRCSECKT ILAIDNAGQV       180
     FLG                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page