(data stored in ACNUC7421 zone)

EMBL: CP002116.PE138

CP002116.PE138       Location/Qualifiers
FT   CDS             144429..144800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce5471 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79298"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F4"
FT                   /protein_id="ADK79298.1"
FT                   /translation="MNAVERYLLNLDLNYEEVAAKTYIIHEPEKGLENVAVMLDEPLVI
FT                   VQVKVMDVPSSGRERFFRTLLNLNATDLIHGAYGVNGDEVILIDTLRSATMDLEEFQAC
FT                   LDAIGLALSQHYRILSDFR"
     MNAVERYLLN LDLNYEEVAA KTYIIHEPEK GLENVAVMLD EPLVIVQVKV MDVPSSGRER        60
     FFRTLLNLNA TDLIHGAYGV NGDEVILIDT LRSATMDLEE FQACLDAIGL ALSQHYRILS       120
     DFR                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page