(data stored in ACNUC7421 zone)

EMBL: CP002116.PE139

CP002116.PE139       Location/Qualifiers
FT   CDS             144822..145508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0142"
FT                   /product="phage shock protein A, PspA"
FT                   /note="COGs: COG1842 Phage shock protein A (IM30)
FT                   suppresses sigma54-dependent transcription; InterPro
FT                   IPR007157; KEGG: hoh:Hoch_0487 phage shock protein A, PspA;
FT                   PFAM: PspA/IM30 family protein; SPTR: Phage shock protein
FT                   A, PspA; PFAM: PspA/IM30 family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79299"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F5"
FT                   /protein_id="ADK79299.1"
FT                   /translation="MGFFQRFRRMIKSNLNEMISKAEDPEKMLDQVIVDMNRQMIESKK
FT                   SVAGAIADEKKLERQLNQTIAAAREWEEKAKLAVRAGKDDLAKEALLRKQEYMGEAAQY
FT                   REQLEGQHDSVEKLKQSLRQLQQKIDEAQRKRNLLIARAKRAKAQQKMQETIKGINQNS
FT                   AFEAFDRLSEKVDRMEAENEAYEELDAPVKDDLERQFEALEDGSGTSADLLLEDLKQRM
FT                   KHEEPS"
     MGFFQRFRRM IKSNLNEMIS KAEDPEKMLD QVIVDMNRQM IESKKSVAGA IADEKKLERQ        60
     LNQTIAAARE WEEKAKLAVR AGKDDLAKEA LLRKQEYMGE AAQYREQLEG QHDSVEKLKQ       120
     SLRQLQQKID EAQRKRNLLI ARAKRAKAQQ KMQETIKGIN QNSAFEAFDR LSEKVDRMEA       180
     ENEAYEELDA PVKDDLERQF EALEDGSGTS ADLLLEDLKQ RMKHEEPS                    228
//

If you have problems or comments...

PBIL Back to PBIL home page