(data stored in ACNUC7421 zone)

EMBL: CP002116.PE14

CP002116.PE14        Location/Qualifiers
FT   CDS             11411..11728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0014"
FT                   /product="ferredoxin"
FT                   /note="COGs: COG0633 Ferredoxin; InterPro IPR001041; KEGG:
FT                   lic:LIC12506 adenylate/guanylate cyclase; PFAM: ferredoxin;
FT                   SPTR: Adenylate cyclase; PFAM: 2Fe-2S iron-sulfur cluster
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79174"
FT                   /db_xref="GOA:E1R6P2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6P2"
FT                   /protein_id="ADK79174.1"
FT                   /translation="MATLIVEGYDRLITASPAISLLNTLLREGIPISHLCGGKAQCGTC
FT                   RVKILDGESFCSPMGERERLRLSGKEGTLPESVRLACQTYIRGRVVVRILASGRSLDKK
FT                   E"
     MATLIVEGYD RLITASPAIS LLNTLLREGI PISHLCGGKA QCGTCRVKIL DGESFCSPMG        60
     ERERLRLSGK EGTLPESVRL ACQTYIRGRV VVRILASGRS LDKKE                       105
//

If you have problems or comments...

PBIL Back to PBIL home page