(data stored in ACNUC7421 zone)

EMBL: CP002116.PE140

CP002116.PE140       Location/Qualifiers
FT   CDS             145492..146151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0143"
FT                   /product="putative two component transcriptional regulator,
FT                   winged helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001867; KEGG: aco:Amico_1683 two
FT                   component transcriptional regulator, winged helix family;
FT                   PFAM: transcriptional regulator domain protein; SPTR: Two
FT                   component transcriptional regulator, winged helix family;
FT                   PFAM: Transcriptional regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79300"
FT                   /db_xref="GOA:E1R8F6"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F6"
FT                   /protein_id="ADK79300.1"
FT                   /translation="MKNHRNNNSFRFVAAGIDSGIRMRLKEATIIDSRFRLKEIDHFTI
FT                   PLEYDGPVILFSTFGVLSSPMLNEIMERGFPLIVSGPASSLLRAFELGVADYLREPWSV
FT                   EELLARCGRIASRFPIPVSDGLLTITSEGITGPGGSVDLSAAEGKLLRLLCSVPGRLVG
FT                   RMELALRVGLENRSRALDVHICHLRKKLVQAVPAWANAHRGPIICERAKGYRFIPS"
     MKNHRNNNSF RFVAAGIDSG IRMRLKEATI IDSRFRLKEI DHFTIPLEYD GPVILFSTFG        60
     VLSSPMLNEI MERGFPLIVS GPASSLLRAF ELGVADYLRE PWSVEELLAR CGRIASRFPI       120
     PVSDGLLTIT SEGITGPGGS VDLSAAEGKL LRLLCSVPGR LVGRMELALR VGLENRSRAL       180
     DVHICHLRKK LVQAVPAWAN AHRGPIICER AKGYRFIPS                              219
//

If you have problems or comments...

PBIL Back to PBIL home page