(data stored in ACNUC7421 zone)

EMBL: CP002116.PE141

CP002116.PE141       Location/Qualifiers
FT   CDS             146453..147415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0144"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rop:ROP_00830 cytochrome c oxidase subunit I;
FT                   SPTR: Cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79301"
FT                   /db_xref="GOA:E1R8F7"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F7"
FT                   /protein_id="ADK79301.1"
FT                   /translation="MVKKIILTPFVHLLWFLVVFIVVFFFIVTYGTVVSSLPGTPNPSL
FT                   FPIAADALWDAFLIAMPLSLFLVIFFIRRRRSFRFLSGIITLVTATLLYAACFIALQTL
FT                   IAPSQIRNDRGPRQLFVEGMFHRFGDVSLYPFTVKDDGSPGESLLIRPGENPCFSLQSG
FT                   FSLQRSGAGVSLVASDGYRLSSPMVNPVVEPYIEPPAIVLRLSYDLETSRDVLLRARED
FT                   GLMFFLLMIGVQCWFCIQSWVIVRAGRWPLMNAVLGIGLFWLFLRAHWFFVSDLWLRFL
FT                   DWLPSSLPYTAITAGAFFFLALPLFFWNIFSSGEAAGHE"
     MVKKIILTPF VHLLWFLVVF IVVFFFIVTY GTVVSSLPGT PNPSLFPIAA DALWDAFLIA        60
     MPLSLFLVIF FIRRRRSFRF LSGIITLVTA TLLYAACFIA LQTLIAPSQI RNDRGPRQLF       120
     VEGMFHRFGD VSLYPFTVKD DGSPGESLLI RPGENPCFSL QSGFSLQRSG AGVSLVASDG       180
     YRLSSPMVNP VVEPYIEPPA IVLRLSYDLE TSRDVLLRAR EDGLMFFLLM IGVQCWFCIQ       240
     SWVIVRAGRW PLMNAVLGIG LFWLFLRAHW FFVSDLWLRF LDWLPSSLPY TAITAGAFFF       300
     LALPLFFWNI FSSGEAAGHE                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page