(data stored in ACNUC7421 zone)

EMBL: CP002116.PE142

CP002116.PE142       Location/Qualifiers
FT   CDS             147408..149150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0145"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR019734:IPR013026; KEGG: tde:TDE0867
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79302"
FT                   /db_xref="GOA:E1R8F8"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F8"
FT                   /protein_id="ADK79302.1"
FT                   /translation="MSKSATGRWLFVLVLFWLIAFGVAFGYAFFTFPADHILPLFRLPW
FT                   SFYTGFDLWIDFLPAVTSASMLLSFSFFFPTIASSNSGKISFFGRIFPGVMAWGIVFTL
FT                   LYVIGAELILPSLTERREDIAYQSERAGEWARQGAAAEALADFSEAYDAYKRALAIDLD
FT                   NPLLVEDLERVEGQIPLAEQGSPPSFIESKTGPTRQELEMQASDALVLAKKAYEDEDYF
FT                   TAHYWALLAARWDPEQKPTAMGIAGRSWEAIGKLSPGQRDEERFGRFAKKIAGYQALEQ
FT                   GDVIEAYQTFLELAGDSEAKSDPDIVEFLERSREAVADVSYSAELAIQAEAMPGVPDLL
FT                   FRDSSNGPFIAAGKMVSIEGKSFLLHLELLALDDDGKQLVHITAPAAQFHGKTLLLRGI
FT                   DPNSGRIVDIPEELFAQRRLYRGNGWMLDLDRGLLALSSDQREIADFGSQSHDLGVSNA
FT                   AALFRSSIRESRHGYFRFPGQLELLFRGSMPFLFLNIMIFSVGLGHFFRFRGERIPIFG
FT                   FLFVPFVPFLMKWAIDLFSYAMRLVTALLLFSVSFSLAFAAMLVFHGIMLFVVLLFSAG
FT                   QRDA"
     MSKSATGRWL FVLVLFWLIA FGVAFGYAFF TFPADHILPL FRLPWSFYTG FDLWIDFLPA        60
     VTSASMLLSF SFFFPTIASS NSGKISFFGR IFPGVMAWGI VFTLLYVIGA ELILPSLTER       120
     REDIAYQSER AGEWARQGAA AEALADFSEA YDAYKRALAI DLDNPLLVED LERVEGQIPL       180
     AEQGSPPSFI ESKTGPTRQE LEMQASDALV LAKKAYEDED YFTAHYWALL AARWDPEQKP       240
     TAMGIAGRSW EAIGKLSPGQ RDEERFGRFA KKIAGYQALE QGDVIEAYQT FLELAGDSEA       300
     KSDPDIVEFL ERSREAVADV SYSAELAIQA EAMPGVPDLL FRDSSNGPFI AAGKMVSIEG       360
     KSFLLHLELL ALDDDGKQLV HITAPAAQFH GKTLLLRGID PNSGRIVDIP EELFAQRRLY       420
     RGNGWMLDLD RGLLALSSDQ REIADFGSQS HDLGVSNAAA LFRSSIRESR HGYFRFPGQL       480
     ELLFRGSMPF LFLNIMIFSV GLGHFFRFRG ERIPIFGFLF VPFVPFLMKW AIDLFSYAMR       540
     LVTALLLFSV SFSLAFAAML VFHGIMLFVV LLFSAGQRDA                             580
//

If you have problems or comments...

PBIL Back to PBIL home page