(data stored in ACNUC7421 zone)

EMBL: CP002116.PE143

CP002116.PE143       Location/Qualifiers
FT   CDS             149143..149604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0146"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="InterPro IPR001623; KEGG: tau:Tola_2364 heat shock
FT                   protein DnaJ domain protein; PFAM: heat shock protein DnaJ
FT                   domain protein; SMART: heat shock protein DnaJ domain
FT                   protein; SPTR: Heat shock protein DnaJ domain protein;
FT                   PFAM: DnaJ domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79303"
FT                   /db_xref="GOA:E1R8F9"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8F9"
FT                   /protein_id="ADK79303.1"
FT                   /translation="MPDMRSFGKGVHLAFERYPMEVLIGLLLGVLIGWGVFGSVIGALC
FT                   GYFFRVLRRQLAAERKECNHEGSIPRGALDGEEQEARRRALAEAYRVLGVDSDSEVEAI
FT                   RKVYRSLAASFHPDGMVALTDEQRRDAEEAFLRIRSAWECIARDRGVRP"
     MPDMRSFGKG VHLAFERYPM EVLIGLLLGV LIGWGVFGSV IGALCGYFFR VLRRQLAAER        60
     KECNHEGSIP RGALDGEEQE ARRRALAEAY RVLGVDSDSE VEAIRKVYRS LAASFHPDGM       120
     VALTDEQRRD AEEAFLRIRS AWECIARDRG VRP                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page