(data stored in ACNUC7421 zone)

EMBL: CP002116.PE145

CP002116.PE145       Location/Qualifiers
FT   CDS             complement(150935..152191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0148"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR018247; KEGG: dse:Dsec_GM19185 GM19185
FT                   gene product from transcript GM19185-RA; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79305"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8G1"
FT                   /protein_id="ADK79305.1"
FT                   /translation="MSPQNRFSKILFFSLVLTGILLLGCGSTPKTIKEQPPPSTSSAET
FT                   GLAEHAATKEREGERTISSSQQGEQEATREQEASTDRSEESAAPPKAMSKEQLMLSVIQ
FT                   AAGQRFTPVRRNNGTPLLAIQDIDQNGEDDAFVLTVEQNGQSIFQSDLGNVKRLYQSQA
FT                   KSVNYYLSVYFQIRGKLISMYRIPFGGRMVLDGFRAFHLRENALYPYAVEAAFQNHDGL
FT                   AIEWVIFSSYNQFSLFSMHRSVSIGSFVEDIDEDGLLDIVEWHKGIEEGTGYETFLTWY
FT                   RWNGTNFGEAGATNIVRNLNAFLSLVEEAILTGTPQKLTPYLSRPVELQKSNDLLKRIF
FT                   TPLDENSLESGLDYCDEIVSIIYPPILENPFSLDSSSGKSVPLDLRLICKNSESLLCRM
FT                   EIAISKNPFVAPQYRIIVR"
     MSPQNRFSKI LFFSLVLTGI LLLGCGSTPK TIKEQPPPST SSAETGLAEH AATKEREGER        60
     TISSSQQGEQ EATREQEAST DRSEESAAPP KAMSKEQLML SVIQAAGQRF TPVRRNNGTP       120
     LLAIQDIDQN GEDDAFVLTV EQNGQSIFQS DLGNVKRLYQ SQAKSVNYYL SVYFQIRGKL       180
     ISMYRIPFGG RMVLDGFRAF HLRENALYPY AVEAAFQNHD GLAIEWVIFS SYNQFSLFSM       240
     HRSVSIGSFV EDIDEDGLLD IVEWHKGIEE GTGYETFLTW YRWNGTNFGE AGATNIVRNL       300
     NAFLSLVEEA ILTGTPQKLT PYLSRPVELQ KSNDLLKRIF TPLDENSLES GLDYCDEIVS       360
     IIYPPILENP FSLDSSSGKS VPLDLRLICK NSESLLCRME IAISKNPFVA PQYRIIVR         418
//

If you have problems or comments...

PBIL Back to PBIL home page