(data stored in ACNUC7421 zone)

EMBL: CP002116.PE146

CP002116.PE146       Location/Qualifiers
FT   CDS             152254..152700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0149"
FT                   /product="FxsA cytoplasmic membrane protein"
FT                   /note="InterPro IPR007313; KEGG: sfr:Sfri_3664 FxsA
FT                   cytoplasmic membrane protein; PFAM: FxsA cytoplasmic
FT                   membrane protein; SPTR: Membrane protein FxsA (Suppressor
FT                   of F exclusion of phage T7); PFAM: FxsA cytoplasmic
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79306"
FT                   /db_xref="GOA:E1R8G2"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8G2"
FT                   /protein_id="ADK79306.1"
FT                   /translation="MADVRDYIRLFDTNNVLKWFFLIMLCGLVLVGEAVVLLFAVDRFS
FT                   RYYVLACLTGSAVIGLLLTWPAVHRIVKHIRKDIAEGEFPEHDMERLLGTIASGIFMLI
FT                   PGFVTDCLGLIIFFFGLRRPVGKLIMMKNRDRLFQAYEYLKLYD"
     MADVRDYIRL FDTNNVLKWF FLIMLCGLVL VGEAVVLLFA VDRFSRYYVL ACLTGSAVIG        60
     LLLTWPAVHR IVKHIRKDIA EGEFPEHDME RLLGTIASGI FMLIPGFVTD CLGLIIFFFG       120
     LRRPVGKLIM MKNRDRLFQA YEYLKLYD                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page