(data stored in ACNUC7421 zone)

EMBL: CP002116.PE147

CP002116.PE147       Location/Qualifiers
FT   CDS             complement(152701..153447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0150"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /note="COGs: COG1922 Teichoic acid biosynthesis protein;
FT                   InterPro IPR004629; KEGG: tde:TDE1876 WecB/TagA/CpsF family
FT                   glycosyl transferase; PFAM: glycosyl transferase
FT                   WecB/TagA/CpsF; SPTR: Glycosyl transferase, WecB/TagA/CpsF
FT                   family; TIGRFAM: glycosyl transferase, WecB/TagA/CpsF
FT                   family; PFAM: Glycosyl transferase WecB/TagA/CpsF family;
FT                   TIGRFAM: bacterial polymer biosynthesis proteins,
FT                   WecB/TagA/CpsF family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79307"
FT                   /db_xref="GOA:E1R8G3"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8G3"
FT                   /protein_id="ADK79307.1"
FT                   /translation="MNDQNRIQIFGVPVDDIDEERFGETIRRLATDNGKHQIVFLDFRG
FT                   LMRARGKGEYADMIRTASLVVPTSKSILAGARFLKLPVPHRHNPFAFVIKLLGAIEQIG
FT                   GTLYLVGSRPDALQKAFGNVRDSFPGLRLVGRYAGYFRKDIERDVITAIKKAGPTILLA
FT                   GDGLKGKALWLKRHERSFGFGISLFCDGCFKIFSGKRQRISNKSWERNSWWIPAVIIRP
FT                   WRWFSFLRYILYGILLFIEKMRRRNL"
     MNDQNRIQIF GVPVDDIDEE RFGETIRRLA TDNGKHQIVF LDFRGLMRAR GKGEYADMIR        60
     TASLVVPTSK SILAGARFLK LPVPHRHNPF AFVIKLLGAI EQIGGTLYLV GSRPDALQKA       120
     FGNVRDSFPG LRLVGRYAGY FRKDIERDVI TAIKKAGPTI LLAGDGLKGK ALWLKRHERS       180
     FGFGISLFCD GCFKIFSGKR QRISNKSWER NSWWIPAVII RPWRWFSFLR YILYGILLFI       240
     EKMRRRNL                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page