(data stored in ACNUC7421 zone)

EMBL: CP002116.PE148

CP002116.PE148       Location/Qualifiers
FT   CDS             complement(153444..154262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0151"
FT                   /product="protein of unknown function DUF558"
FT                   /note="COGs: COG1385 conserved hypothetical protein;
FT                   InterPro IPR006700; KEGG: adg:Adeg_0610 protein of unknown
FT                   function DUF558; PFAM: protein of unknown function DUF558;
FT                   SPTR: RNA methyltransferase family protein; PFAM: RNA
FT                   methyltransferase; TIGRFAM: RNA methyltransferase, RsmE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79308"
FT                   /db_xref="GOA:E1R8G4"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8G4"
FT                   /protein_id="ADK79308.1"
FT                   /translation="MRTFVLDDSETKLASGKRFSPAPERAHYLLRVLRLSQGAVFPGQD
FT                   SRGKRYLITLESETPCTLSLRREEEASAREVEACFRELPEQGPDFPPIIFYQAILKGKK
FT                   MDQVIRQATEAGADFIIPVLTDRSVPQFTPGEAEKKQKRWEIIVREAIQQSGATGTTLL
FT                   LPRSLKKVIEDPPMPRPQGGGREVKLFFHERPIANGSLHGYLSGEISSITAAVGPEGGF
FT                   SPKESEMFLQAGFCPLFFSGNILRAETAAIYGLAAIRALVAERDIWRLVQ"
     MRTFVLDDSE TKLASGKRFS PAPERAHYLL RVLRLSQGAV FPGQDSRGKR YLITLESETP        60
     CTLSLRREEE ASAREVEACF RELPEQGPDF PPIIFYQAIL KGKKMDQVIR QATEAGADFI       120
     IPVLTDRSVP QFTPGEAEKK QKRWEIIVRE AIQQSGATGT TLLLPRSLKK VIEDPPMPRP       180
     QGGGREVKLF FHERPIANGS LHGYLSGEIS SITAAVGPEG GFSPKESEMF LQAGFCPLFF       240
     SGNILRAETA AIYGLAAIRA LVAERDIWRL VQ                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page