(data stored in ACNUC7421 zone)

EMBL: CP002116.PE149

CP002116.PE149       Location/Qualifiers
FT   CDS             complement(154273..154677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0152"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="COGs: COG0432 conserved hypothetical protein;
FT                   InterPro IPR001602; KEGG: hor:Hore_00760 hypothetical
FT                   protein; PFAM: protein of unknown function UPF0047; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterised
FT                   protein family UPF0047; TIGRFAM: conserved hypothetical
FT                   protein TIGR00149"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79309"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8G5"
FT                   /protein_id="ADK79309.1"
FT                   /translation="MNRWETVLNIKTSGRSDMVDITDKITSAVQESGVRNGICMVYIPH
FT                   TTCAVTINENADPAVKHDIMAELDKIVPWKDAYHHMEGNSAAHIKSSMFGFSQTIPITE
FT                   GALPLGTWQGIYLCEFDGPRSRTVSVQIFG"
     MNRWETVLNI KTSGRSDMVD ITDKITSAVQ ESGVRNGICM VYIPHTTCAV TINENADPAV        60
     KHDIMAELDK IVPWKDAYHH MEGNSAAHIK SSMFGFSQTI PITEGALPLG TWQGIYLCEF       120
     DGPRSRTVSV QIFG                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page