(data stored in ACNUC7421 zone)

EMBL: CP002116.PE15

CP002116.PE15        Location/Qualifiers
FT   CDS             11795..12805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0015"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="COGs: COG1609 Transcriptional regulators; InterPro
FT                   IPR000843:IPR001761; KEGG: sth:STH770 LacI family
FT                   transcriptional repressor; PFAM: periplasmic binding
FT                   protein/LacI transcriptional regulator; regulatory protein
FT                   LacI; SMART: regulatory protein LacI; SPTR: LacI family
FT                   transcriptional repressor; PFAM: Bacterial regulatory
FT                   proteins, lacI family; family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79175"
FT                   /db_xref="GOA:E1R6P3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6P3"
FT                   /protein_id="ADK79175.1"
FT                   /translation="MKKQTINDVARLSGVGKATVSRVFSGSPLVSEATRERVLETAREI
FT                   GYHPNPVARALTTAKTGNITIVLPSLQSFVMSQIVRGAMFAANKNGYSLFVLDSGEDSD
FT                   KSGADYSDLLHEHASDGVIFCYESARQQMESVSLRRPVLFLESTPTKESLDCIRTDNRT
FT                   GMRLLVEYLFELGHKRIAAVFGRRSPYSENRYIHFIAAMEGVGLPVTEDHLLFSNWAIE
FT                   DGYRDFRSLMGLPFSSRPSAIVFISDFMATGALRAAADMGIAVPDEVSIAGTDDAETSA
FT                   FLIPGLTTLGFDPHGLGEKAVEQLIRRIQYPDEEALHLVVPVTLRKRGSTGPVKW"
     MKKQTINDVA RLSGVGKATV SRVFSGSPLV SEATRERVLE TAREIGYHPN PVARALTTAK        60
     TGNITIVLPS LQSFVMSQIV RGAMFAANKN GYSLFVLDSG EDSDKSGADY SDLLHEHASD       120
     GVIFCYESAR QQMESVSLRR PVLFLESTPT KESLDCIRTD NRTGMRLLVE YLFELGHKRI       180
     AAVFGRRSPY SENRYIHFIA AMEGVGLPVT EDHLLFSNWA IEDGYRDFRS LMGLPFSSRP       240
     SAIVFISDFM ATGALRAAAD MGIAVPDEVS IAGTDDAETS AFLIPGLTTL GFDPHGLGEK       300
     AVEQLIRRIQ YPDEEALHLV VPVTLRKRGS TGPVKW                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page