(data stored in ACNUC7421 zone)

EMBL: CP002116.PE150

CP002116.PE150       Location/Qualifiers
FT   CDS             complement(154674..156176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0153"
FT                   /product="carboxyl-terminal protease"
FT                   /note="COGs: COG0793 Periplasmic protease; InterPro
FT                   IPR004447:IPR001478:IPR005151; KEGG: bga:BG0359
FT                   carboxyl-terminal protease; PFAM: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein; SMART: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein; SPTR: Carboxy--processing
FT                   protease; TIGRFAM: carboxyl-terminal protease; PFAM:
FT                   Peptidase family S41; PDZ domain (Also known as DHR or
FT                   GLGF); TIGRFAM: C-terminal peptidase (prc)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79310"
FT                   /db_xref="GOA:E1R8G6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8G6"
FT                   /protein_id="ADK79310.1"
FT                   /translation="MKQIRNRLAWLMVAIVTVSFSLFLIITPTLSAQSSSSVEVKNYLA
FT                   RFQYIFQYILQAYVDEVDPKQLYEGALNGMFDTLDDPWSYYLSEDDMEDLNNNTTVGRY
FT                   GGVGLYIARPVPVDEKDKGKVMKIPDQWPELDTTKEDLPFIKVVSPIEDTPAYRKGIHS
FT                   GDYIIAIGDQSTENMTSDDASGKMKGLPGTDVTVTILRGKNIIFDVTITRASIEIPTVK
FT                   EAMIPGRIGYIRIIQFSPYTEPRVREALKTLNSQGYDSLIIDVRGNGGGLLNAAVNIID
FT                   MFLSSGPIVSTKGRIAEENKVFNATSSLEVAADVPIAILIDGGSASASEILAGAFKDTG
FT                   RGYLIGNTSFGKGLVQTVVPLGREGFKLTISRYYTPSGVNINGTGIEPNLKIAEPELND
FT                   EENASLKKLFEEHLVENFVNGNPKPSEQEQKAFARRLQQEEEITLPFDLLMRLIRGEVF
FT                   RRMDQPPVYDLDYDPVLKKAVSLLETGAIQPTTGTLAQEQKQ"
     MKQIRNRLAW LMVAIVTVSF SLFLIITPTL SAQSSSSVEV KNYLARFQYI FQYILQAYVD        60
     EVDPKQLYEG ALNGMFDTLD DPWSYYLSED DMEDLNNNTT VGRYGGVGLY IARPVPVDEK       120
     DKGKVMKIPD QWPELDTTKE DLPFIKVVSP IEDTPAYRKG IHSGDYIIAI GDQSTENMTS       180
     DDASGKMKGL PGTDVTVTIL RGKNIIFDVT ITRASIEIPT VKEAMIPGRI GYIRIIQFSP       240
     YTEPRVREAL KTLNSQGYDS LIIDVRGNGG GLLNAAVNII DMFLSSGPIV STKGRIAEEN       300
     KVFNATSSLE VAADVPIAIL IDGGSASASE ILAGAFKDTG RGYLIGNTSF GKGLVQTVVP       360
     LGREGFKLTI SRYYTPSGVN INGTGIEPNL KIAEPELNDE ENASLKKLFE EHLVENFVNG       420
     NPKPSEQEQK AFARRLQQEE EITLPFDLLM RLIRGEVFRR MDQPPVYDLD YDPVLKKAVS       480
     LLETGAIQPT TGTLAQEQKQ                                                   500
//

If you have problems or comments...

PBIL Back to PBIL home page