(data stored in ACNUC7421 zone)

EMBL: CP002116.PE151

CP002116.PE151       Location/Qualifiers
FT   CDS             156266..156727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0154"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cla:Cla_0909 sodium-dependent transporter (SNF
FT                   family); SPTR: Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79311"
FT                   /db_xref="GOA:E1R8G7"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8G7"
FT                   /protein_id="ADK79311.1"
FT                   /translation="MIKKLVLLLIVLWEAFRAVGLFFSAVALLNPTYRTETTLLMGWLF
FT                   SGSLTVLATEALLLFRGPTAQGGRILPGIAALGKFVTLLPGIMLFLLLSGVGPQQDQTP
FT                   LLLFPFRTIIALVSFVDLLCIGFLLLLLKDGSGTSRPDSDYRFTVVEEE"
     MIKKLVLLLI VLWEAFRAVG LFFSAVALLN PTYRTETTLL MGWLFSGSLT VLATEALLLF        60
     RGPTAQGGRI LPGIAALGKF VTLLPGIMLF LLLSGVGPQQ DQTPLLLFPF RTIIALVSFV       120
     DLLCIGFLLL LLKDGSGTSR PDSDYRFTVV EEE                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page