(data stored in ACNUC7421 zone)

EMBL: CP002116.PE152

CP002116.PE152       Location/Qualifiers
FT   CDS             156728..157870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0155"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="COGs: COG0455 ATPase involved in chromosome
FT                   partitioning; InterPro IPR002586; KEGG: tde:TDE1397
FT                   flagellar synthesis regulator FleN, putative; PFAM:
FT                   Cobyrinic acid ac-diamide synthase; SPTR: ATP-binding
FT                   protein; PFAM: CobQ/CobB/MinD/ParA nucleotide binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79312"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8G8"
FT                   /protein_id="ADK79312.1"
FT                   /translation="MRILPIASGKGGVGKSLVAANLSIALAQSGKKVVLADLDLGASNL
FT                   HLILGVRAVQQGIGTFLTNAEIEFEEVILPTDYPNLRFIPGDAEIPGMANLKSSQKAKL
FT                   IRKLRTIEADYIIIDLGAGTSYNTLDFFLSSSRGIIVTAPTLTATLNAYLFLKNSVFRL
FT                   MNGAFRKSSPAGKYIENLQREGTPLQRVYIPRLLERIMEEDPDSYKNFARSMANFHPML
FT                   VLNMLEDPEDGKKAARIRRSCKQYLDVDMEHLGVLYFDHLQEIALGSRIPIVAYKPQSV
FT                   LSQGIYRIADKLIQKQDEGESPLDLMSLEESYQVAEMEAEIDFEAKVQDMENLLHSGAL
FT                   TRGDLIDTIRSQQYEISTLKKENQLLKSKLLKAAENGFQI"
     MRILPIASGK GGVGKSLVAA NLSIALAQSG KKVVLADLDL GASNLHLILG VRAVQQGIGT        60
     FLTNAEIEFE EVILPTDYPN LRFIPGDAEI PGMANLKSSQ KAKLIRKLRT IEADYIIIDL       120
     GAGTSYNTLD FFLSSSRGII VTAPTLTATL NAYLFLKNSV FRLMNGAFRK SSPAGKYIEN       180
     LQREGTPLQR VYIPRLLERI MEEDPDSYKN FARSMANFHP MLVLNMLEDP EDGKKAARIR       240
     RSCKQYLDVD MEHLGVLYFD HLQEIALGSR IPIVAYKPQS VLSQGIYRIA DKLIQKQDEG       300
     ESPLDLMSLE ESYQVAEMEA EIDFEAKVQD MENLLHSGAL TRGDLIDTIR SQQYEISTLK       360
     KENQLLKSKL LKAAENGFQI                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page