(data stored in ACNUC7421 zone)

EMBL: CP002116.PE153

CP002116.PE153       Location/Qualifiers
FT   CDS             157889..160840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0156"
FT                   /product="protein of unknown function DUF342"
FT                   /note="COGs: COG1315 polymerase most protein contain PALM
FT                   domain HD hydrolase domain and Zn-ribbon domain; InterPro
FT                   IPR005646; KEGG: tde:TDE1398 hypothetical protein; PFAM:
FT                   protein of unknown function DUF342; SPTR: Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF342)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79313"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8G9"
FT                   /protein_id="ADK79313.1"
FT                   /translation="MEQGKGSLKIEINEGGLNATLVLTADPEGEVWSLPKVQNVLEEKG
FT                   IIEGVSKAAVQEALQAFAEAEAGISVRKEIARGTEPEPATSEYYEWKELPLPESLKTQA
FT                   DRLFLEYAFPDIKIKRTEKVKVRKKVLKKSKLLFVAPKEQIVEEWQKKIVEEPAPINPK
FT                   VAATGYVEQGEYIAELRAGEPGKDGRSVLGKPLSPDPAKPILFYPGKGVKVDRNGLVAE
FT                   KSGFFRRGSNWVEVFDFLSHSWELSLSKDKATLLFAFTPGHREASIPEPSLIISKAGEE
FT                   FGFSVEQLKGPDKLREVMTRSVQTGKALERIPLTRDRDAFFSVEASSDNLKGLLTVVKG
FT                   SGRGKPLILRDVGAAIKASGFSGLDFGKIQNDLLEFYHGNGIELRDYLLAEGAAPSRGE
FT                   DRSFDFSVDFLPETEYEALKVGESGFPSEEAYPMSQARSLARVAEGTVVGVLSSAQEGS
FT                   PGKDVYGKVIPGIPGIDPHIELLENVRMEKERFIAETAGLLEVFDGADGIILRVRPYRD
FT                   AEVKIELSTDKMEAWLTIEPPAGSGTKANRSEIDQALKEVGIVKGIIEEAITDALEISG
FT                   AGSPVRRSVVARGKRPDDAGGSRIALIADRASGKGVTITRSGRADYRNQDRFVSVKAGA
FT                   LLAEILPNDQPAEDGWDLTGKPISAKDAPALDIDIGENIRQEEEGNRIKLYAACSGEFV
FT                   YEKKKLDILKVHTVSGDVDFSSGNVKFSGTVAVSGSVRSGFSILAEGHVKVAGNAESSL
FT                   ISSGESITIAQGIVGGGKAVIRAKSSIETIFAEQATLLAVGSVSMKNACLRCMVKCNGR
FT                   LRLVGEKGNLIGGVVRAREGVIAANIGNPKGSRTEISFGQDYLVMDRIELEEREVKKLR
FT                   NALARIDTTMASLEKQGDKGRLEMARKEKLKMMKMLEKRSMLLFTLRERFEQHFDSSVV
FT                   VRGTVYPGVVIESHGRYWSTETPKKGITLIFDQETGRIIEVSEAEPKEGEKSA"
     MEQGKGSLKI EINEGGLNAT LVLTADPEGE VWSLPKVQNV LEEKGIIEGV SKAAVQEALQ        60
     AFAEAEAGIS VRKEIARGTE PEPATSEYYE WKELPLPESL KTQADRLFLE YAFPDIKIKR       120
     TEKVKVRKKV LKKSKLLFVA PKEQIVEEWQ KKIVEEPAPI NPKVAATGYV EQGEYIAELR       180
     AGEPGKDGRS VLGKPLSPDP AKPILFYPGK GVKVDRNGLV AEKSGFFRRG SNWVEVFDFL       240
     SHSWELSLSK DKATLLFAFT PGHREASIPE PSLIISKAGE EFGFSVEQLK GPDKLREVMT       300
     RSVQTGKALE RIPLTRDRDA FFSVEASSDN LKGLLTVVKG SGRGKPLILR DVGAAIKASG       360
     FSGLDFGKIQ NDLLEFYHGN GIELRDYLLA EGAAPSRGED RSFDFSVDFL PETEYEALKV       420
     GESGFPSEEA YPMSQARSLA RVAEGTVVGV LSSAQEGSPG KDVYGKVIPG IPGIDPHIEL       480
     LENVRMEKER FIAETAGLLE VFDGADGIIL RVRPYRDAEV KIELSTDKME AWLTIEPPAG       540
     SGTKANRSEI DQALKEVGIV KGIIEEAITD ALEISGAGSP VRRSVVARGK RPDDAGGSRI       600
     ALIADRASGK GVTITRSGRA DYRNQDRFVS VKAGALLAEI LPNDQPAEDG WDLTGKPISA       660
     KDAPALDIDI GENIRQEEEG NRIKLYAACS GEFVYEKKKL DILKVHTVSG DVDFSSGNVK       720
     FSGTVAVSGS VRSGFSILAE GHVKVAGNAE SSLISSGESI TIAQGIVGGG KAVIRAKSSI       780
     ETIFAEQATL LAVGSVSMKN ACLRCMVKCN GRLRLVGEKG NLIGGVVRAR EGVIAANIGN       840
     PKGSRTEISF GQDYLVMDRI ELEEREVKKL RNALARIDTT MASLEKQGDK GRLEMARKEK       900
     LKMMKMLEKR SMLLFTLRER FEQHFDSSVV VRGTVYPGVV IESHGRYWST ETPKKGITLI       960
     FDQETGRIIE VSEAEPKEGE KSA                                               983
//

If you have problems or comments...

PBIL Back to PBIL home page