(data stored in ACNUC7421 zone)

EMBL: CP002116.PE155

CP002116.PE155       Location/Qualifiers
FT   CDS             161842..162195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0158"
FT                   /product="Hpt protein"
FT                   /note="InterPro IPR008207; KEGG: srm:SRM_02645 conserved
FT                   hypothetical protein containing Hpt domain; PFAM: Hpt
FT                   domain protein; SPTR: Probable sensor/response hybrid,
FT                   putative; PFAM: Hpt domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79315"
FT                   /db_xref="GOA:E1R8H1"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H1"
FT                   /protein_id="ADK79315.1"
FT                   /translation="MRCMETIIHFDAAESALRLDRETLLMLLDAFFSTREDYIKPIKGA
FT                   IESRDAEALRSEAHRLKGAANNLRVTKIGTLAQTLEKSSSDADPSLLLSTLEQIEVSFS
FT                   AGEKELSVLKSEV"
     MRCMETIIHF DAAESALRLD RETLLMLLDA FFSTREDYIK PIKGAIESRD AEALRSEAHR        60
     LKGAANNLRV TKIGTLAQTL EKSSSDADPS LLLSTLEQIE VSFSAGEKEL SVLKSEV          117
//

If you have problems or comments...

PBIL Back to PBIL home page