(data stored in ACNUC7421 zone)

EMBL: CP002116.PE156

CP002116.PE156       Location/Qualifiers
FT   CDS             162200..164248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0159"
FT                   /product="Alpha-galactosidase"
FT                   /note="COGs: COG3345 Alpha-galactosidase; KEGG:
FT                   shi:Shel_06470 alpha-galactosidase; SPTR: Putative
FT                   uncharacterized protein; PFAM: Melibiase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79316"
FT                   /db_xref="GOA:E1R8H2"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H2"
FT                   /protein_id="ADK79316.1"
FT                   /translation="MNTSWSILFSYHLGSEEFELGGLSGGATFADGVRIVVEQRKLPLG
FT                   ERILFHAEPAPGGEGLFPVAERLELRLRCSSCEAVFLNGYQSWTESRELEAEVFPFRFR
FT                   RLFRPWINHYLLDRYGDACFTGRSFSKKRYHGCSFATLRKGKQVTLLAGMIEDRALSRI
FT                   EWRSERRGRGYLSFLPELSSNKISGVRTLMDLVVLTGEEEAVYEGWASAADGFGPVEPG
FT                   ESLSGWTSWYDHYEKVTEADVLRVLDSWQRLSLPPGVIQIDDGWQQAVGDWLRVKPTFP
FT                   RGMAPLAADISKAGMEPGLWVAPFIAEGSSLLFAEHRDWFLTDDAAEPLAAGNNPFNWS
FT                   GYFYALNIYHPEVKTYLRTLFSTIVKQWGFRFLKLDFLYAAALRLPEGKTRGEVMRDAV
FT                   AFLREISGEAKLLGCGVPLASAAGLVEYCRVGADVALRWEDRRLRALGYPERVSTLNAL
FT                   RSTISRRGLDGRFFLNDPDVFLLRDWNSDLNEQERFTLFLCNHIFGSLLFTSDDPGRYD
FT                   EATLALFRSGYPLRKKHGLRMNRIGECFEIEFSIGTLCYLAFINLENRPHHVTLASGLY
FT                   YAYGEGFRREGPLDLRPHQSICFLVVGETDFAVAGSTGMLFPGSEVERIDVDGEHVTLS
FT                   LAPGTLSEGLLFFRAPQGASGCSINGIDIEAEEKVGLRLCVVEKRLL"
     MNTSWSILFS YHLGSEEFEL GGLSGGATFA DGVRIVVEQR KLPLGERILF HAEPAPGGEG        60
     LFPVAERLEL RLRCSSCEAV FLNGYQSWTE SRELEAEVFP FRFRRLFRPW INHYLLDRYG       120
     DACFTGRSFS KKRYHGCSFA TLRKGKQVTL LAGMIEDRAL SRIEWRSERR GRGYLSFLPE       180
     LSSNKISGVR TLMDLVVLTG EEEAVYEGWA SAADGFGPVE PGESLSGWTS WYDHYEKVTE       240
     ADVLRVLDSW QRLSLPPGVI QIDDGWQQAV GDWLRVKPTF PRGMAPLAAD ISKAGMEPGL       300
     WVAPFIAEGS SLLFAEHRDW FLTDDAAEPL AAGNNPFNWS GYFYALNIYH PEVKTYLRTL       360
     FSTIVKQWGF RFLKLDFLYA AALRLPEGKT RGEVMRDAVA FLREISGEAK LLGCGVPLAS       420
     AAGLVEYCRV GADVALRWED RRLRALGYPE RVSTLNALRS TISRRGLDGR FFLNDPDVFL       480
     LRDWNSDLNE QERFTLFLCN HIFGSLLFTS DDPGRYDEAT LALFRSGYPL RKKHGLRMNR       540
     IGECFEIEFS IGTLCYLAFI NLENRPHHVT LASGLYYAYG EGFRREGPLD LRPHQSICFL       600
     VVGETDFAVA GSTGMLFPGS EVERIDVDGE HVTLSLAPGT LSEGLLFFRA PQGASGCSIN       660
     GIDIEAEEKV GLRLCVVEKR LL                                                682
//

If you have problems or comments...

PBIL Back to PBIL home page