(data stored in ACNUC7421 zone)

EMBL: CP002116.PE157

CP002116.PE157       Location/Qualifiers
FT   CDS             164351..165319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0160"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD subfamily"
FT                   /note="COGs: COG0568 DNA-directed RNA polymerase sigma
FT                   subunit (sigma70/sigma32);
FT                   InterProIPR000943:IPR014284:IPR009042:IPR007627:IPR
FT                   007624:IPR007630; KEGG: tcu:Tcur_3197 RNA polymerase, sigma
FT                   70 subunit, RpoD subfamily; PFAM: sigma-70 region 4 domain
FT                   protein; sigma-70 region 2 domain protein; sigma-70 region
FT                   1.2; sigma-70 region 3 domain protein; SPTR: RNA polymerase
FT                   sigma factor; TIGRFAM: RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: Sigma-70, region 4; Sigma-70 region
FT                   3; Sigma-70 region 2; Sigma-70 factor, region 1.2; TIGRFAM:
FT                   RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79317"
FT                   /db_xref="GOA:E1R8H3"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H3"
FT                   /protein_id="ADK79317.1"
FT                   /translation="MKYGTYSDTVIDSDVDFNDSDPLSLYLKQISAYPLLTKEEELMIG
FT                   REIQERKQELLELEELLGKEEIERSAYLFRKRTIEAVLRKSRDRMITSNLRLVVSIAKK
FT                   YQHRGLSFLDLIDEGNIGLIEAVERFDYTKRCKFSTYGTWWIQQSVIKALADKGRTIRI
FT                   PIHVLNIIRKLFSVTKHLTQELGRDPSSAEIAAYMDLPVERVESILQYSGETASLDVTV
FT                   DDENITSLSDLVFSDDYIEPFESVFHVTLKDLLDTILGQLSEREQTIIKLRFGLADRTP
FT                   LTLEEIGSILGITRERVRQIQNKAIEKLRSIAAIQELEEIV"
     MKYGTYSDTV IDSDVDFNDS DPLSLYLKQI SAYPLLTKEE ELMIGREIQE RKQELLELEE        60
     LLGKEEIERS AYLFRKRTIE AVLRKSRDRM ITSNLRLVVS IAKKYQHRGL SFLDLIDEGN       120
     IGLIEAVERF DYTKRCKFST YGTWWIQQSV IKALADKGRT IRIPIHVLNI IRKLFSVTKH       180
     LTQELGRDPS SAEIAAYMDL PVERVESILQ YSGETASLDV TVDDENITSL SDLVFSDDYI       240
     EPFESVFHVT LKDLLDTILG QLSEREQTII KLRFGLADRT PLTLEEIGSI LGITRERVRQ       300
     IQNKAIEKLR SIAAIQELEE IV                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page