(data stored in ACNUC7421 zone)

EMBL: CP002116.PE158

CP002116.PE158       Location/Qualifiers
FT   CDS             165410..165775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0161"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG2204 Response regulator containing
FT                   CheY-like receiver AAA-type ATPase and DNA-binding domains;
FT                   InterPro IPR001789; KEGG: gsu:GSU1289 chemotaxis protein
FT                   CheY; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; SPTR: Chemotaxis protein CheY; PFAM:
FT                   Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79318"
FT                   /db_xref="GOA:E1R8H4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H4"
FT                   /protein_id="ADK79318.1"
FT                   /translation="MTKKVLVVDDSRAIRRSISFVLEQNGYEVLEASDGVVGLAKLEEG
FT                   TVELIITDVNMPNMDGITFIKKVRELDAFRFVPILVLTTESQKSVMEDGKAAGATGWIV
FT                   KPFSTDKLMAAVRRVAG"
     MTKKVLVVDD SRAIRRSISF VLEQNGYEVL EASDGVVGLA KLEEGTVELI ITDVNMPNMD        60
     GITFIKKVRE LDAFRFVPIL VLTTESQKSV MEDGKAAGAT GWIVKPFSTD KLMAAVRRVA       120
     G                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page