(data stored in ACNUC7421 zone)

EMBL: CP002116.PE159

CP002116.PE159       Location/Qualifiers
FT   CDS             complement(165785..166672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0162"
FT                   /product="high-affinity nickel-transporter"
FT                   /note="COGs: COG2215 ABC-type uncharacterized transport
FT                   system permease component; InterPro IPR011541; KEGG:
FT                   dap:Dacet_2269 high-affinity nickel-transporter; PFAM:
FT                   high-affinity nickel-transporter; SPTR: High-affinity
FT                   nickel-transporter; PFAM: High-affinity nickel-transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79319"
FT                   /db_xref="GOA:E1R8H5"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H5"
FT                   /protein_id="ADK79319.1"
FT                   /translation="MNTRHRYVLFPFIFIIIFVTNSWGQQVNPFTATQKAPTESKQSSQ
FT                   PQKAVESGTLQTLSSMQKQLNAALSDTMKQLKDHPSAPVMALTMLIAFGYGFIHALGPG
FT                   HRKTILAALFASGRYRKRDALGAGMGFAFLHASSAVAIVGFLYFLSSGPISAGMDKIGL
FT                   ALEKGSFLLLVGIGLWIMISAIRALMAKEDKPAKKGVTVITIIGSGLIPCPGAALILSF
FT                   ALVYDIVPYGIVAVFCMSVGMGTALSIIAVAAKSIGASLIKLGERSKRTDRIHSALEFA
FT                   GGVVITTFALFMLT"
     MNTRHRYVLF PFIFIIIFVT NSWGQQVNPF TATQKAPTES KQSSQPQKAV ESGTLQTLSS        60
     MQKQLNAALS DTMKQLKDHP SAPVMALTML IAFGYGFIHA LGPGHRKTIL AALFASGRYR       120
     KRDALGAGMG FAFLHASSAV AIVGFLYFLS SGPISAGMDK IGLALEKGSF LLLVGIGLWI       180
     MISAIRALMA KEDKPAKKGV TVITIIGSGL IPCPGAALIL SFALVYDIVP YGIVAVFCMS       240
     VGMGTALSII AVAAKSIGAS LIKLGERSKR TDRIHSALEF AGGVVITTFA LFMLT            295
//

If you have problems or comments...

PBIL Back to PBIL home page