(data stored in ACNUC7421 zone)

EMBL: CP002116.PE16

CP002116.PE16        Location/Qualifiers
FT   CDS             13031..14173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0016"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="COGs: COG1454 Alcohol dehydrogenase class IV;
FT                   InterPro IPR001670:IPR018211; KEGG: lsp:Bsph_4187
FT                   NAD-dependent methanol dehydrogenase; PFAM: iron-containing
FT                   alcohol dehydrogenase; SPTR: Putative uncharacterized
FT                   protein; PFAM: Iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79176"
FT                   /db_xref="GOA:E1R6P4"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6P4"
FT                   /protein_id="ADK79176.1"
FT                   /translation="MKKAILNLPTALYCGRGCRSGLAECIPQEAKVALVTDKGLVGAPP
FT                   LDLVTTIFDEADISWKLISDIDPNPDEETVLRVVKAVKAMQADVIVAIGGGSPLDTAKA
FT                   AACMARNDGPLSDYQWEGKPFVNAPLPLYALPTTAGTGSEVTGVAVITSRNMKKGINAR
FT                   EIFPKAAFVDPELMIGLPPYLTAITGMDALTHAIEAYVGLGANPFSDALCEKAIELIAD
FT                   HLPRAFSYGGDIEAREAMGTASSLAGLAMDQAGLGIVHSLSSPVCAYLHVSHGLANAML
FT                   LPHGMRYNLPARHEKFAVVAELMGYDTTGMTPRDAAEAAVVAVEDLLEELELGSAIEEV
FT                   VHNAVDFEEFGNNASKMFLIRNNPRGADSKACRSIFETIF"
     MKKAILNLPT ALYCGRGCRS GLAECIPQEA KVALVTDKGL VGAPPLDLVT TIFDEADISW        60
     KLISDIDPNP DEETVLRVVK AVKAMQADVI VAIGGGSPLD TAKAAACMAR NDGPLSDYQW       120
     EGKPFVNAPL PLYALPTTAG TGSEVTGVAV ITSRNMKKGI NAREIFPKAA FVDPELMIGL       180
     PPYLTAITGM DALTHAIEAY VGLGANPFSD ALCEKAIELI ADHLPRAFSY GGDIEAREAM       240
     GTASSLAGLA MDQAGLGIVH SLSSPVCAYL HVSHGLANAM LLPHGMRYNL PARHEKFAVV       300
     AELMGYDTTG MTPRDAAEAA VVAVEDLLEE LELGSAIEEV VHNAVDFEEF GNNASKMFLI       360
     RNNPRGADSK ACRSIFETIF                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page