(data stored in ACNUC7421 zone)

EMBL: CP002116.PE160

CP002116.PE160       Location/Qualifiers
FT   CDS             complement(166684..167337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0163"
FT                   /product="protein of unknown function DUF1007"
FT                   /note="COGs: COG3683 ABC-type uncharacterized transport
FT                   system periplasmic component; InterPro IPR010412; KEGG:
FT                   tde:TDE0115 hypothetical protein; PFAM: protein of unknown
FT                   function DUF1007; SPTR: Putative uncharacterized protein;
FT                   PFAM: Protein of unknown function (DUF1007)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79320"
FT                   /db_xref="InterPro:IPR010412"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H6"
FT                   /protein_id="ADK79320.1"
FT                   /translation="MKLEKRHLPLFLFVFTLFIPCTLFAHPHMFIDSKTTLEFDEAGMK
FT                   GFWVEWLFDQFFTAQILLDYDRNMDKNFSADEISAIEAGAFSNLANYHYFISVTTGEAQ
FT                   VDIKKVSDFRAFMKDDRLGYTFFVPMAIPINNEKKPVQFRISIFDDTFFCDIAWMEKDS
FT                   VIVRAPGVFSVDWKILRNKNAPIIYDPTGGTARRNGVDYSGTVYPEELYIEVSK"
     MKLEKRHLPL FLFVFTLFIP CTLFAHPHMF IDSKTTLEFD EAGMKGFWVE WLFDQFFTAQ        60
     ILLDYDRNMD KNFSADEISA IEAGAFSNLA NYHYFISVTT GEAQVDIKKV SDFRAFMKDD       120
     RLGYTFFVPM AIPINNEKKP VQFRISIFDD TFFCDIAWME KDSVIVRAPG VFSVDWKILR       180
     NKNAPIIYDP TGGTARRNGV DYSGTVYPEE LYIEVSK                                217
//

If you have problems or comments...

PBIL Back to PBIL home page