(data stored in ACNUC7421 zone)

EMBL: CP002116.PE161

CP002116.PE161       Location/Qualifiers
FT   CDS             complement(167360..169501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0164"
FT                   /product="ferrous iron transport protein B"
FT                   /note="COGs: COG0370 Fe2+ transport system protein B;
FT                   InterProIPR005225:IPR003373:IPR002917:IPR011619:IPR
FT                   011642:IPR011640; KEGG: pgi:PG1294 ferrous iron transport
FT                   protein B; PFAM: Ferrous iron transport protein B domain
FT                   protein; GTP-binding protein HSR1-related; nucleoside
FT                   recognition domain protein; Ferrous iron transport B domain
FT                   protein; SPTR: Ferrous iron transport protein B; TIGRFAM:
FT                   ferrous iron transport protein B; small GTP-binding
FT                   protein; PFAM: Ferrous iron transport protein B; Ferrous
FT                   iron transport protein B C terminus; Nucleoside
FT                   recognition; TIGRFAM: ferrous iron transporter FeoB; small
FT                   GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79321"
FT                   /db_xref="GOA:E1R8H7"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H7"
FT                   /protein_id="ADK79321.1"
FT                   /translation="MGSFRFALTGNPNSGKTSIFNAATGANQKVGNWGGVTVDVKEGNI
FT                   RRGNDRVTLIDIPGTYSLSAYTMEELVAREVIIKGDADVIINVLDSTNLERNLYLGVQV
FT                   MEMGRPMVLAFNMSDELKRSGTVIDTEALSRLFGIPIRFTVGRNGEGVRELLDEAIRVA
FT                   KGEHPATRQVSVNYGKEIEAAIESLAELVEKSSFNLRGISPRWYALKLLERDDEILRKV
FT                   RERVPADSPDDNVIFKELESRSKEIEQLYGEDAATIISERRYGFIIGALNETVNKPKAN
FT                   RINISEKIDDVLTNRFLAYPIFAFFMWILFQTTFGLGAYPMAWIESGITALGNWIGTTM
FT                   PPGAIRDLLTDGVIAGVGGVLVFLPNILILFLGISILEDTGYMARIAFIMDKVMHRIGL
FT                   HGKSFIPLVMGVGCSVPAIMAARTLESKKDRILTILIAPLITCSARLPVYILFTGAFFP
FT                   NIAGNVIFILYFLSFLFAFGMGWLFRKTLFRGEEYPFVMELPPYRIPTFRSALIHMWEK
FT                   AKHYLQKMGGVVLIFSIIIWFLGNYPKQPEMEKQYDTMIAEQREQGHQEEVQALQRELK
FT                   RKQVMQSYIGKAGTFIEPVLAPLGFDWRMDVSLMTGFVAKEVVVSTLGVLFTAGNEEGK
FT                   EESGTELRDALRDAYSPLVGFAFLIFVMLYTPCIVAFVTLVKEVGSWKWSIFSLGYQLT
FT                   LAWIAAFIVYRGGIILGLG"
     MGSFRFALTG NPNSGKTSIF NAATGANQKV GNWGGVTVDV KEGNIRRGND RVTLIDIPGT        60
     YSLSAYTMEE LVAREVIIKG DADVIINVLD STNLERNLYL GVQVMEMGRP MVLAFNMSDE       120
     LKRSGTVIDT EALSRLFGIP IRFTVGRNGE GVRELLDEAI RVAKGEHPAT RQVSVNYGKE       180
     IEAAIESLAE LVEKSSFNLR GISPRWYALK LLERDDEILR KVRERVPADS PDDNVIFKEL       240
     ESRSKEIEQL YGEDAATIIS ERRYGFIIGA LNETVNKPKA NRINISEKID DVLTNRFLAY       300
     PIFAFFMWIL FQTTFGLGAY PMAWIESGIT ALGNWIGTTM PPGAIRDLLT DGVIAGVGGV       360
     LVFLPNILIL FLGISILEDT GYMARIAFIM DKVMHRIGLH GKSFIPLVMG VGCSVPAIMA       420
     ARTLESKKDR ILTILIAPLI TCSARLPVYI LFTGAFFPNI AGNVIFILYF LSFLFAFGMG       480
     WLFRKTLFRG EEYPFVMELP PYRIPTFRSA LIHMWEKAKH YLQKMGGVVL IFSIIIWFLG       540
     NYPKQPEMEK QYDTMIAEQR EQGHQEEVQA LQRELKRKQV MQSYIGKAGT FIEPVLAPLG       600
     FDWRMDVSLM TGFVAKEVVV STLGVLFTAG NEEGKEESGT ELRDALRDAY SPLVGFAFLI       660
     FVMLYTPCIV AFVTLVKEVG SWKWSIFSLG YQLTLAWIAA FIVYRGGIIL GLG              713
//

If you have problems or comments...

PBIL Back to PBIL home page