(data stored in ACNUC7421 zone)

EMBL: CP002116.PE162

CP002116.PE162       Location/Qualifiers
FT   CDS             complement(169501..169779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0165"
FT                   /product="FeoA family protein"
FT                   /note="COGs: COG1918 Fe2+ transport system protein A;
FT                   InterPro IPR007167; KEGG: dat:HRM2_10920 Fur; PFAM: FeoA
FT                   family protein; SPTR: Fur; PFAM: FeoA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79322"
FT                   /db_xref="GOA:E1R8H8"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H8"
FT                   /protein_id="ADK79322.1"
FT                   /translation="MKKTLSQYRQGDIVTITRLNGSGRLKNRLMELGFRRGETISIIRY
FT                   APLKDPVEILVAGCNVSLRVEEADMIEVEPAKDQYIHAAEGECAGSL"
     MKKTLSQYRQ GDIVTITRLN GSGRLKNRLM ELGFRRGETI SIIRYAPLKD PVEILVAGCN        60
     VSLRVEEADM IEVEPAKDQY IHAAEGECAG SL                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page