(data stored in ACNUC7421 zone)

EMBL: CP002116.PE163

CP002116.PE163       Location/Qualifiers
FT   CDS             170022..172286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0166"
FT                   /product="5-methyltetrahydropteroyltriglutamate/homocystei
FT                   neS-methyltransferase"
FT                   /EC_number="2.1.1.14"
FT                   /note="COGs: COG0620 Methionine synthase II
FT                   (cobalamin-independent); InterPro
FT                   IPR006276:IPR013215:IPR002629; KEGG: drm:Dred_1751
FT                   5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase; PFAM: Methionine synthase vitamin-B12
FT                   independent; Cobalamin-independent synthase MetE domain
FT                   protein;
FT                   PRIAM:5-methyltetrahydropteroyltriglutamate--homocy
FT                   steineS-methyltransferase;
FT                   SPTR:5-methyltetrahydropteroyltriglutamate--homocys
FT                   teinemethyltransferase;
FT                   TIGRFAM:5-methyltetrahydropteroyltriglutamate/homoc
FT                   ysteineS-methyltransferase; PFAM: Cobalamin-independent
FT                   synthase, N-terminal domain; Cobalamin-independent
FT                   synthase, Catalytic domain; TIGRFAM:
FT                   5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79323"
FT                   /db_xref="GOA:E1R8H9"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8H9"
FT                   /protein_id="ADK79323.1"
FT                   /translation="MICKTLVTGFPRIGENRELKRALEHYWSKTASLQELRATAAELRK
FT                   RHWLFQKRQNIDFISSNDFSYYDNMLDTIVMLNAVPDRFSGIEDETERYFAMARGTAGA
FT                   SAMTMSKWFDTNYHYIVPELSGTLDFRLCPGKILTEYAEAKKLGVKTKINVIGPITFMG
FT                   LSRASKGENPFGYASRIIPLYKELLARCAELDDTLYIQMEEPYLVKNPTAEVLALLKAA
FT                   YQDLASVSSNIRIIVTSYFEHSNETTKILAETPIWGLGLDFVHGPQNIQGLKYAKGKKI
FT                   FAGVVDGRNIWRNDLGASLFLLEKISDMVGREQVVVSTSCSLLHVPYSLQNEPESDIKQ
FT                   HLAFCCEKVEELALLGRVFRGEVVLDSDNIGMKTARSRTPSTQHDGPADIAFGERKVRA
FT                   GDFAERNALQRRKFHLPKLPTTTIGSFPQTQELRRLRRDFKKRAISEEAYEQGIKTYID
FT                   DCIAFQEEIGLDVLVHGEPERNDMVEYFGEMLKGFHFTDNGWVQSYGSRCVKPPIIYGD
FT                   ISRTKPMTVRWISYAQRRSKKPVKGMLTGPVTILNWSFVREDIPRPLVARQIAAALCEE
FT                   VADLQAAGISIIQVDEAAFREGYPLRKENVSAYERWAVDSFRLAVSSAAKETQIHTHMC
FT                   YSDFTDIIKTIEAMDADVITIETARGGNRLLDVFEREGYHNEIGPGVYDIHSPRIPSED
FT                   EFEKQIFSRLEVLDGKRMWINPDCGLKTRRWEEVRPALQHMVSATRNVRLTLERNETSL
FT                   T"
     MICKTLVTGF PRIGENRELK RALEHYWSKT ASLQELRATA AELRKRHWLF QKRQNIDFIS        60
     SNDFSYYDNM LDTIVMLNAV PDRFSGIEDE TERYFAMARG TAGASAMTMS KWFDTNYHYI       120
     VPELSGTLDF RLCPGKILTE YAEAKKLGVK TKINVIGPIT FMGLSRASKG ENPFGYASRI       180
     IPLYKELLAR CAELDDTLYI QMEEPYLVKN PTAEVLALLK AAYQDLASVS SNIRIIVTSY       240
     FEHSNETTKI LAETPIWGLG LDFVHGPQNI QGLKYAKGKK IFAGVVDGRN IWRNDLGASL       300
     FLLEKISDMV GREQVVVSTS CSLLHVPYSL QNEPESDIKQ HLAFCCEKVE ELALLGRVFR       360
     GEVVLDSDNI GMKTARSRTP STQHDGPADI AFGERKVRAG DFAERNALQR RKFHLPKLPT       420
     TTIGSFPQTQ ELRRLRRDFK KRAISEEAYE QGIKTYIDDC IAFQEEIGLD VLVHGEPERN       480
     DMVEYFGEML KGFHFTDNGW VQSYGSRCVK PPIIYGDISR TKPMTVRWIS YAQRRSKKPV       540
     KGMLTGPVTI LNWSFVREDI PRPLVARQIA AALCEEVADL QAAGISIIQV DEAAFREGYP       600
     LRKENVSAYE RWAVDSFRLA VSSAAKETQI HTHMCYSDFT DIIKTIEAMD ADVITIETAR       660
     GGNRLLDVFE REGYHNEIGP GVYDIHSPRI PSEDEFEKQI FSRLEVLDGK RMWINPDCGL       720
     KTRRWEEVRP ALQHMVSATR NVRLTLERNE TSLT                                   754
//

If you have problems or comments...

PBIL Back to PBIL home page