(data stored in ACNUC7421 zone)

EMBL: CP002116.PE164

CP002116.PE164       Location/Qualifiers
FT   CDS             172378..172701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0167"
FT                   /product="FeoA family protein"
FT                   /note="InterPro IPR007167; KEGG: iho:Igni_1229 FeoA family
FT                   protein; PFAM: FeoA family protein; SPTR: FeoA family
FT                   protein; PFAM: FeoA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79324"
FT                   /db_xref="GOA:E1R8I0"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8I0"
FT                   /protein_id="ADK79324.1"
FT                   /translation="MHNTFAMKFGLDRGRRHMFHGHGHRNHHCQEMGSVVLSGVDAGSS
FT                   VRVVCLFGGQDAKRKLLDMGLVPGELLKVVQNDSDGPLLLQVQGSRLMIGRGLADKIRV
FT                   AAA"
     MHNTFAMKFG LDRGRRHMFH GHGHRNHHCQ EMGSVVLSGV DAGSSVRVVC LFGGQDAKRK        60
     LLDMGLVPGE LLKVVQNDSD GPLLLQVQGS RLMIGRGLAD KIRVAAA                     107
//

If you have problems or comments...

PBIL Back to PBIL home page