(data stored in ACNUC7421 zone)

EMBL: CP002116.PE166

CP002116.PE166       Location/Qualifiers
FT   CDS             173032..175332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0169"
FT                   /product="ferrous iron transport protein B"
FT                   /note="COGs: COG0370 Fe2+ transport system protein B;
FT                   InterProIPR006073:IPR005225:IPR003373:IPR002917:IPR
FT                   011619:IPR011642:IPR011640; KEGG: cpb:Cphamn1_0623 ferrous
FT                   iron transport protein B; PFAM: Ferrous iron transport
FT                   protein B domain protein; GTP-binding protein HSR1-related;
FT                   nucleoside recognition domain protein; Ferrous iron
FT                   transport B domain protein; SPTR: Ferrous iron transport
FT                   protein B; TIGRFAM: ferrous iron transport protein B; small
FT                   GTP-binding protein; PFAM: Ferrous iron transport protein
FT                   B; Ferrous iron transport protein B C terminus; Nucleoside
FT                   recognition; TIGRFAM: ferrous iron transporter FeoB; small
FT                   GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79326"
FT                   /db_xref="GOA:E1R8I2"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8I2"
FT                   /protein_id="ADK79326.1"
FT                   /translation="MKRVEGGASVSNFTIALAGNPNCGKTTLFNALTGGNQRIGNWPGV
FT                   TVEKKEGWLSGSKQRKVVDLPGIYSLNAGSEDERVARDYLLSGEADLVVNIVDASHLER
FT                   NLYLTTTIMEMGVPVVLFLNMMDLLEKEGSTINIKELESALGVPVVAGTATDKKSVAEA
FT                   VARITELVGNVRPSDHKPVYPNEIEELISKWEKQAGGRWNALALYEGTAPSELHGRIPT
FT                   EKIAAEREKISSLLKEESEVILADSRYGFIRGVIHDVFHAQERRRSVSEQIDKVVLNRF
FT                   LGIPIFLVVMYLMFWLAISVGSSFIDFFDVLFGTIFVDGFGVLLGSIGSPDWVVSFLAG
FT                   GVGAGIQTVATFVPVVFFMFLALSLLEDSGYMARAAFVMDRLMRALGLPGKAFVPMIVG
FT                   FGCTVPAILATRTLENKRDRFMTIFMAPFMSCGARLPVYALFGAALFGAHAGAIVFSIY
FT                   IIGVLLAVLTGLFLKHSLFRGEPGYFIMELPPYHAPRFKHVMIHTWTRLKVFLARAGKV
FT                   IVIAVFLLGVLNSLGTDGSFGNEDTENSVLAVTGKAITPIFSPMGIKEESWPATVGLFT
FT                   GLFAKEAVVGTLNGLYGQIAAAENNVAGDEGGEEEAFSLGAGIKDSFVALKDGVLGISG
FT                   GIGSIVGADVISGGDEEAVAEAAEVDISIFSLMRRGFTPVSGYAYLLFVLIYFPCLAAF
FT                   GAIVKEMGIGLGILEAIYLTVSAWAVAVFYYQIAEGGNFLWMIVSAAIMVAQFFVFRAI
FT                   GNRNRKKEALQSA"
     MKRVEGGASV SNFTIALAGN PNCGKTTLFN ALTGGNQRIG NWPGVTVEKK EGWLSGSKQR        60
     KVVDLPGIYS LNAGSEDERV ARDYLLSGEA DLVVNIVDAS HLERNLYLTT TIMEMGVPVV       120
     LFLNMMDLLE KEGSTINIKE LESALGVPVV AGTATDKKSV AEAVARITEL VGNVRPSDHK       180
     PVYPNEIEEL ISKWEKQAGG RWNALALYEG TAPSELHGRI PTEKIAAERE KISSLLKEES       240
     EVILADSRYG FIRGVIHDVF HAQERRRSVS EQIDKVVLNR FLGIPIFLVV MYLMFWLAIS       300
     VGSSFIDFFD VLFGTIFVDG FGVLLGSIGS PDWVVSFLAG GVGAGIQTVA TFVPVVFFMF       360
     LALSLLEDSG YMARAAFVMD RLMRALGLPG KAFVPMIVGF GCTVPAILAT RTLENKRDRF       420
     MTIFMAPFMS CGARLPVYAL FGAALFGAHA GAIVFSIYII GVLLAVLTGL FLKHSLFRGE       480
     PGYFIMELPP YHAPRFKHVM IHTWTRLKVF LARAGKVIVI AVFLLGVLNS LGTDGSFGNE       540
     DTENSVLAVT GKAITPIFSP MGIKEESWPA TVGLFTGLFA KEAVVGTLNG LYGQIAAAEN       600
     NVAGDEGGEE EAFSLGAGIK DSFVALKDGV LGISGGIGSI VGADVISGGD EEAVAEAAEV       660
     DISIFSLMRR GFTPVSGYAY LLFVLIYFPC LAAFGAIVKE MGIGLGILEA IYLTVSAWAV       720
     AVFYYQIAEG GNFLWMIVSA AIMVAQFFVF RAIGNRNRKK EALQSA                      766
//

If you have problems or comments...

PBIL Back to PBIL home page